BLASTX nr result
ID: Alisma22_contig00016714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00016714 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF34888.1 conserved hypothetical protein [Ricinus communis] 51 7e-07 >EEF34888.1 conserved hypothetical protein [Ricinus communis] Length = 60 Score = 51.2 bits (121), Expect = 7e-07 Identities = 24/50 (48%), Positives = 29/50 (58%) Frame = +3 Query: 60 ARSKFAAESCGLG*GPSRISPRGEGAMLGWLHRAALPPVVDSGRIIGPCL 209 ARSK + CGLG GP + PR EG LGW HRAA+ + + GP L Sbjct: 5 ARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVL 54