BLASTX nr result
ID: Alisma22_contig00016606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00016606 (1165 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP08360.1 unnamed protein product [Coffea canephora] 74 1e-10 JAU39130.1 Pentatricopeptide repeat-containing protein, mitochon... 69 1e-10 XP_012858952.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 2e-10 XP_016175164.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-10 XP_015941141.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-10 XP_015953398.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-10 XP_015941137.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 3e-10 XP_010104829.1 hypothetical protein L484_024029 [Morus notabilis... 73 3e-10 XP_019424230.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 5e-10 XP_017627084.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 6e-10 XP_016728564.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 6e-10 XP_002265980.4 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-09 XP_016716292.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-09 XP_012475837.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-09 XP_011031955.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-09 JAU23710.1 Pentatricopeptide repeat-containing protein, mitochon... 65 1e-09 OMO85290.1 hypothetical protein COLO4_21676 [Corchorus olitorius] 70 2e-09 XP_008797170.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-09 XP_006440204.1 hypothetical protein CICLE_v10019492mg [Citrus cl... 70 3e-09 JAV01267.1 Pentatricopeptide repeat-containing protein, mitochon... 69 3e-09 >CDP08360.1 unnamed protein product [Coffea canephora] Length = 676 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/83 (42%), Positives = 57/83 (68%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPY--PTLHVVDDEANKK 584 Y ++ ++V+ + G+++ +L SIH+ LNE+EK ++ AGY P LH V+ + ++ Sbjct: 544 YSWMEIKNVVHEFRSGDRLHPELDSIHEKLNELEKKMKLAGYVPNLESDLHDVEKQQKEQ 603 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 + LLHSEKL+IA+GL+S PPG P Sbjct: 604 ILLLHSEKLAIAYGLISLPPGEP 626 >JAU39130.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 141 Score = 68.9 bits (167), Expect = 1e-10 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ R+ + + ++I +L SIH+ L E+EK ++ AGY P LH V++E KK Sbjct: 9 YSWIEIRNKVHHFRSSDRIHPELDSIHKKLKELEKKMKLAGYKPELEFALHDVEEEQKKK 68 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL++AFG L P G P Sbjct: 69 LLLWHSEKLAVAFGCLKLPQGSP 91 >XP_012858952.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Erythranthe guttata] Length = 653 Score = 73.2 bits (178), Expect = 2e-10 Identities = 38/83 (45%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPY--PTLHVVDDEANKK 584 Y I+ +SV+ + G+++ +L IH+ LNE+EK ++ AGY P LH V +E ++ Sbjct: 521 YSWIEIKSVMHEFRSGDRVHSELECIHEKLNELEKKMKLAGYLPVLESALHDVTEEQKEQ 580 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P GVP Sbjct: 581 LLLGHSEKLAIAFGLLKLPLGVP 603 >XP_016175164.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Arachis ipaensis] XP_016175165.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Arachis ipaensis] XP_016175166.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Arachis ipaensis] XP_016175167.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Arachis ipaensis] XP_016175168.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Arachis ipaensis] XP_016175169.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Arachis ipaensis] Length = 642 Score = 72.8 bits (177), Expect = 3e-10 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +SV+ + +++ +L SIH+ LNE+EK ++ AGY P LH V++E ++ Sbjct: 510 YSWIEIKSVVHEFRSSDRLHPELVSIHKKLNELEKKMKMAGYIPDLEFALHDVEEELKEQ 569 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P GVP Sbjct: 570 LLLWHSEKLAIAFGLLKVPLGVP 592 >XP_015941141.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X2 [Arachis duranensis] Length = 642 Score = 72.8 bits (177), Expect = 3e-10 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +SV+ + +++ +L SIH+ LNE+EK ++ AGY P LH V++E ++ Sbjct: 510 YSWIEIKSVVHEFRSSDRLHPELVSIHKKLNELEKKMKMAGYIPDLEFALHDVEEELKEQ 569 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P GVP Sbjct: 570 LLLWHSEKLAIAFGLLKVPLGVP 592 >XP_015953398.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Arachis duranensis] Length = 642 Score = 72.8 bits (177), Expect = 3e-10 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +SV+ + +++ +L SIH+ LNE+EK ++ AGY P LH V++E ++ Sbjct: 510 YSWIEIKSVVHEFRSSDRLHPELVSIHKKLNELEKKMKMAGYIPDLEFALHDVEEELKEQ 569 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P GVP Sbjct: 570 LLLWHSEKLAIAFGLLKVPLGVP 592 >XP_015941137.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Arachis duranensis] XP_015941138.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Arachis duranensis] XP_015941139.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Arachis duranensis] XP_015941140.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like isoform X1 [Arachis duranensis] Length = 662 Score = 72.8 bits (177), Expect = 3e-10 Identities = 38/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +SV+ + +++ +L SIH+ LNE+EK ++ AGY P LH V++E ++ Sbjct: 530 YSWIEIKSVVHEFRSSDRLHPELVSIHKKLNELEKKMKMAGYIPDLEFALHDVEEELKEQ 589 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P GVP Sbjct: 590 LLLWHSEKLAIAFGLLKVPLGVP 612 >XP_010104829.1 hypothetical protein L484_024029 [Morus notabilis] EXC02065.1 hypothetical protein L484_024029 [Morus notabilis] Length = 670 Score = 72.8 bits (177), Expect = 3e-10 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +SV+ + G+++ +L+SIH+ L+E++K ++ AGY P LH V E ++ Sbjct: 538 YSWIEVKSVVHEFRSGDRVQPELASIHEKLDELDKKMKLAGYVPDLEFALHDVGQEQKEQ 597 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P G+P Sbjct: 598 LLLRHSEKLAIAFGLLKVPEGIP 620 >XP_019424230.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Lupinus angustifolius] Length = 636 Score = 72.0 bits (175), Expect = 5e-10 Identities = 38/83 (45%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ SV+ + +++ +L+SIH+ LNE+EK ++ AGY P LH V +E ++ Sbjct: 504 YSWIEINSVVHEFRSSDRLHPELASIHEKLNELEKKMKLAGYVPDLEFALHDVGEELKEQ 563 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGLL P GVP Sbjct: 564 LLLWHSEKLAIAFGLLKVPLGVP 586 >XP_017627084.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Gossypium arboreum] Length = 687 Score = 72.0 bits (175), Expect = 6e-10 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSP--YPTLHVVDDEANKK 584 Y I+ +S + + G+++ +L+SIH+ LNE+EK ++ AGY P LH V +E ++ Sbjct: 555 YSWIEIKSTVHEFRSGDRVHPELASIHEKLNELEKKMKLAGYVPDLESALHDVGEEQKEQ 614 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGL+ P G P Sbjct: 615 LLLWHSEKLAIAFGLIVVPYGTP 637 >XP_016728564.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Gossypium hirsutum] Length = 687 Score = 72.0 bits (175), Expect = 6e-10 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSP--YPTLHVVDDEANKK 584 Y I+ +S + + G+++ +L+SIH+ LNE+EK ++ AGY P LH V +E ++ Sbjct: 555 YSWIEIKSTVHEFRSGDRVHPELASIHEKLNELEKKMKLAGYVPDLESALHDVGEEQKEQ 614 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGL+ P G P Sbjct: 615 LLLWHSEKLAIAFGLIVVPYGTP 637 >XP_002265980.4 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Vitis vinifera] Length = 657 Score = 70.9 bits (172), Expect = 1e-09 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSP--YPTLHVVDDEANKK 584 Y I+ +SV+ + G++I +L+ IH+ LNE+E+ +R AGY P LH V +E K+ Sbjct: 525 YSWIEVKSVVHEFRSGDRIHPELAFIHEKLNELERKMRLAGYVPDLEYALHDVGEEQKKQ 584 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 + L HSEKL+IA+GL+ P G P Sbjct: 585 ILLRHSEKLAIAYGLIRMPLGTP 607 >XP_016716292.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Gossypium hirsutum] Length = 687 Score = 70.9 bits (172), Expect = 1e-09 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSP--YPTLHVVDDEANKK 584 Y I+ ++ + + G+++ +L+SIH+ LNE+EK ++ AGY P LH V +E ++ Sbjct: 555 YSWIEIKNTVHEFRSGDRVHPELASIHEKLNELEKKMKLAGYVPDLESALHDVGEEQKEQ 614 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGL+ P G P Sbjct: 615 LLLWHSEKLAIAFGLIVVPYGTP 637 >XP_012475837.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Gossypium raimondii] KJB25486.1 hypothetical protein B456_004G194300 [Gossypium raimondii] Length = 687 Score = 70.9 bits (172), Expect = 1e-09 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSP--YPTLHVVDDEANKK 584 Y I+ ++ + + G+++ +L+SIH+ LNE+EK ++ AGY P LH V +E ++ Sbjct: 555 YSWIEIKNTVHEFRSGDRVHPELASIHEKLNELEKKMKLAGYVPDLESALHDVGEEQKEQ 614 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGL+ P G P Sbjct: 615 LLLWHSEKLAIAFGLIVVPYGTP 637 >XP_011031955.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial [Populus euphratica] Length = 688 Score = 70.9 bits (172), Expect = 1e-09 Identities = 36/83 (43%), Positives = 53/83 (63%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +S+ + G+K +L+SIH+ L E+EK ++ AGY P LH V +E ++ Sbjct: 556 YSWIEVKSMAHQFRSGDKFHPELASIHEKLKELEKKMKLAGYVPDLEFALHDVGEEQKEQ 615 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IA+GL+ PPG P Sbjct: 616 LLLWHSEKLAIAYGLIKLPPGTP 638 >JAU23710.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 118 Score = 65.5 bits (158), Expect = 1e-09 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = -1 Query: 709 EKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKKLFLLHSEKLSIAFGLL 536 ++I +L SIH+ L E+EK ++ AGY P LH V++E KKL L HSEKL+IAFG L Sbjct: 2 DRIHPELDSIHKKLKELEKKMKLAGYKPELEFALHDVEEEQKKKLLLWHSEKLAIAFGCL 61 Query: 535 STPPGVP 515 P G P Sbjct: 62 KLPQGSP 68 >OMO85290.1 hypothetical protein COLO4_21676 [Corchorus olitorius] Length = 631 Score = 70.5 bits (171), Expect = 2e-09 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y ++ +SV+ + G+++ +L SIH+ LNE+EK ++ AGY P LH + +E ++ Sbjct: 499 YSWMEIKSVVHEFRSGDRVHPELPSIHEKLNELEKKMKLAGYVPDLDFALHDLGEEQKEQ 558 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGL+ P G P Sbjct: 559 LLLRHSEKLAIAFGLMKVPHGTP 581 >XP_008797170.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Phoenix dactylifera] XP_008797171.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Phoenix dactylifera] XP_008776007.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Phoenix dactylifera] XP_008776008.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Phoenix dactylifera] Length = 654 Score = 70.5 bits (171), Expect = 2e-09 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 2/81 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSP--YPTLHVVDDEANKK 584 Y I+ R V+ + G+++ LQL+ IH+ L+E+EK ++K GY P LH V +E + Sbjct: 522 YSWIEVRGVVHEFRSGDRVHLQLNLIHEKLSELEKKMKKVGYVPDLQFALHDVGEEQKEM 581 Query: 583 LFLLHSEKLSIAFGLLSTPPG 521 + + HSEKL+IAFGL+ST G Sbjct: 582 MLMRHSEKLAIAFGLISTSSG 602 >XP_006440204.1 hypothetical protein CICLE_v10019492mg [Citrus clementina] ESR53444.1 hypothetical protein CICLE_v10019492mg [Citrus clementina] Length = 571 Score = 69.7 bits (169), Expect = 3e-09 Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ +V+ + G+++ +L SIH+ L E+EK ++ AGY P LH V +E ++ Sbjct: 439 YSWIEVGTVVHEFRSGDRVHPELVSIHEKLKELEKKMKLAGYVPDLEFVLHAVGEEVKEQ 498 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL+IAFGL+ P G P Sbjct: 499 LLLFHSEKLAIAFGLIKVPLGTP 521 >JAV01267.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 366 Score = 68.9 bits (167), Expect = 3e-09 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = -1 Query: 757 YISIQPRSVIQTLKYGEKIDLQLSSIHQNLNEIEKSIRKAGYSPYP--TLHVVDDEANKK 584 Y I+ R+ + + ++I +L SIH+ L E+EK ++ AGY P LH V++E KK Sbjct: 284 YSWIEIRNKVHHFRSSDRIHPELDSIHKKLKELEKKMKLAGYKPELEFALHDVEEEQKKK 343 Query: 583 LFLLHSEKLSIAFGLLSTPPGVP 515 L L HSEKL++AFG L P G P Sbjct: 344 LLLWHSEKLAVAFGCLKLPQGSP 366