BLASTX nr result
ID: Alisma22_contig00016584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00016584 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009347785.1 PREDICTED: putative disease resistance protein At... 53 4e-06 XP_008808655.1 PREDICTED: disease resistance protein RGA2-like [... 53 5e-06 >XP_009347785.1 PREDICTED: putative disease resistance protein At3g14460 [Pyrus x bretschneideri] XP_018501048.1 PREDICTED: putative disease resistance protein At3g14460 [Pyrus x bretschneideri] Length = 1126 Score = 53.1 bits (126), Expect = 4e-06 Identities = 20/38 (52%), Positives = 31/38 (81%) Frame = -3 Query: 269 EFGLPGTLNELRIEGCPLLQEECKSTGSEWPKVSYIPK 156 E GLP +L+EL ++ CPLLQ+ C+S G +WPK+++IP+ Sbjct: 1081 EEGLPASLSELILKKCPLLQQRCQSEGEDWPKIAHIPR 1118 >XP_008808655.1 PREDICTED: disease resistance protein RGA2-like [Phoenix dactylifera] Length = 1241 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/42 (54%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -3 Query: 269 EFGLPGTLNELRIEGCPLLQEEC-KSTGSEWPKVSYIPKRTI 147 E GLPG+LN L I CP+L++ C K G +WPK++YIPK I Sbjct: 1161 ENGLPGSLNMLDIRDCPILEDRCRKDAGPDWPKIAYIPKLDI 1202