BLASTX nr result
ID: Alisma22_contig00016458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00016458 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU60643.1 Fatty acyl-CoA reductase 2, partial [Noccaea caerules... 70 1e-13 XP_010257805.1 PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA re... 73 2e-13 XP_016184500.1 PREDICTED: fatty acyl-CoA reductase 2-like [Arach... 73 2e-13 XP_015951354.1 PREDICTED: fatty acyl-CoA reductase 2-like [Arach... 73 2e-13 XP_003535102.2 PREDICTED: fatty acyl-CoA reductase 2-like [Glyci... 73 2e-13 KHN43996.1 Fatty acyl-CoA reductase 2 [Glycine soja] 73 2e-13 JAU20240.1 Fatty acyl-CoA reductase 2, partial [Noccaea caerules... 69 3e-13 XP_018490808.1 PREDICTED: fatty acyl-CoA reductase 2-like [Rapha... 73 3e-13 XP_010557956.1 PREDICTED: fatty acyl-CoA reductase 2-like [Taren... 72 5e-13 XP_013640161.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brass... 72 6e-13 XP_013585594.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brass... 72 6e-13 CDY01079.1 BnaC05g41210D [Brassica napus] 72 6e-13 CDY08472.1 BnaA05g27080D [Brassica napus] 72 6e-13 XP_013710647.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brass... 72 6e-13 XP_009146656.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brass... 72 6e-13 XP_007145718.1 hypothetical protein PHAVU_007G262300g [Phaseolus... 72 8e-13 KYP53438.1 Fatty acyl-CoA reductase 2 [Cajanus cajan] 71 1e-12 JAU85107.1 Fatty acyl-CoA reductase 2, partial [Noccaea caerules... 71 1e-12 KRH71795.1 hypothetical protein GLYMA_02G169100 [Glycine max] 71 2e-12 KHN00025.1 Fatty acyl-CoA reductase 2 [Glycine soja] 71 2e-12 >JAU60643.1 Fatty acyl-CoA reductase 2, partial [Noccaea caerulescens] Length = 121 Score = 69.7 bits (169), Expect = 1e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 110 LGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 +G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR +PDVGKI Sbjct: 42 VGMKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMSPDVGKI 86 >XP_010257805.1 PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 2 [Nelumbo nucifera] Length = 315 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = +2 Query: 92 GGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 G ++T +G +G+ IVRFL GK+ LITGATGFLAK+L+EKILR PDVGKI Sbjct: 105 GPTTTLMGSHDGIGIVRFLKGKQFLITGATGFLAKILVEKILRTVPDVGKI 155 >XP_016184500.1 PREDICTED: fatty acyl-CoA reductase 2-like [Arachis ipaensis] Length = 587 Score = 73.2 bits (178), Expect = 2e-13 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = +2 Query: 86 YDGGSSTEL-GPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 Y G +ST L G E+G+ IV+FL GKK ITGATGFLAKVLIEKILR PDVGKI Sbjct: 76 YGGPTSTTLVGFEDGIGIVKFLRGKKFFITGATGFLAKVLIEKILRTEPDVGKI 129 >XP_015951354.1 PREDICTED: fatty acyl-CoA reductase 2-like [Arachis duranensis] Length = 587 Score = 73.2 bits (178), Expect = 2e-13 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = +2 Query: 86 YDGGSSTEL-GPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 Y G +ST L G E+G+ IV+FL GKK ITGATGFLAKVLIEKILR PDVGKI Sbjct: 76 YGGPTSTTLVGFEDGIGIVKFLRGKKFFITGATGFLAKVLIEKILRTEPDVGKI 129 >XP_003535102.2 PREDICTED: fatty acyl-CoA reductase 2-like [Glycine max] Length = 608 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +2 Query: 92 GGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 GG++T +G E+G+ IV+FL GKK ITGATGFLAKV IEKILR PDVGK+ Sbjct: 99 GGTTTLIGLEDGIGIVKFLGGKKFFITGATGFLAKVFIEKILRTEPDVGKM 149 >KHN43996.1 Fatty acyl-CoA reductase 2 [Glycine soja] Length = 608 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +2 Query: 92 GGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 GG++T +G E+G+ IV+FL GKK ITGATGFLAKV IEKILR PDVGK+ Sbjct: 99 GGTTTLIGLEDGIGIVKFLGGKKFFITGATGFLAKVFIEKILRTEPDVGKM 149 >JAU20240.1 Fatty acyl-CoA reductase 2, partial [Noccaea caerulescens] Length = 117 Score = 68.9 bits (167), Expect = 3e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +2 Query: 110 LGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 +G +EGL IV FL GK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 8 VGMKEGLGIVSFLQGKNFLITGSTGFLAKVLIEKVLRMAPDVGKI 52 >XP_018490808.1 PREDICTED: fatty acyl-CoA reductase 2-like [Raphanus sativus] Length = 616 Score = 72.8 bits (177), Expect = 3e-13 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = +2 Query: 86 YDGGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 Y GG++ +G +EGL IV FL GKK LI+G+TGFLAKVLIEK+LR APDVGKI Sbjct: 109 YSGGAAM-VGSKEGLGIVSFLQGKKFLISGSTGFLAKVLIEKVLRMAPDVGKI 160 >XP_010557956.1 PREDICTED: fatty acyl-CoA reductase 2-like [Tarenaya hassleriana] Length = 617 Score = 72.4 bits (176), Expect = 5e-13 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +2 Query: 95 GSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 G+S+ G +EGL I+ +L GK+ LITGATGFLAKVLIEKILR APDVG+I Sbjct: 120 GTSSSAGLKEGLGIINYLQGKRFLITGATGFLAKVLIEKILRMAPDVGRI 169 >XP_013640161.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brassica napus] Length = 612 Score = 72.0 bits (175), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 101 STELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 + ++G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 109 AAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 156 >XP_013585594.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brassica oleracea var. oleracea] XP_013585595.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brassica oleracea var. oleracea] Length = 612 Score = 72.0 bits (175), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 101 STELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 + ++G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 109 AAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 156 >CDY01079.1 BnaC05g41210D [Brassica napus] Length = 612 Score = 72.0 bits (175), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 101 STELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 + ++G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 109 AAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 156 >CDY08472.1 BnaA05g27080D [Brassica napus] Length = 613 Score = 72.0 bits (175), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 101 STELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 + ++G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 110 AAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 157 >XP_013710647.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brassica napus] Length = 614 Score = 72.0 bits (175), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 101 STELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 + ++G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 110 AAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 157 >XP_009146656.1 PREDICTED: fatty acyl-CoA reductase 2-like [Brassica rapa] Length = 614 Score = 72.0 bits (175), Expect = 6e-13 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 101 STELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 + ++G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 111 AAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 158 >XP_007145718.1 hypothetical protein PHAVU_007G262300g [Phaseolus vulgaris] ESW17712.1 hypothetical protein PHAVU_007G262300g [Phaseolus vulgaris] Length = 608 Score = 71.6 bits (174), Expect = 8e-13 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = +2 Query: 92 GGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 GG +T +G E+G IV+FL GKK ITGATGFLAKV IEKILR PDVGK+ Sbjct: 99 GGPTTLIGLEDGTGIVKFLRGKKFFITGATGFLAKVFIEKILRTEPDVGKM 149 >KYP53438.1 Fatty acyl-CoA reductase 2 [Cajanus cajan] Length = 580 Score = 71.2 bits (173), Expect = 1e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +2 Query: 98 SSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 SST +G E+G+ IV+FL GKK ITGATGFLAKV IEKILR PDVGK+ Sbjct: 100 SSTLIGLEDGIGIVKFLRGKKFFITGATGFLAKVFIEKILRTEPDVGKM 148 >JAU85107.1 Fatty acyl-CoA reductase 2, partial [Noccaea caerulescens] Length = 377 Score = 70.9 bits (172), Expect = 1e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +2 Query: 110 LGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 +G +EGL IV FL GKK LITG+TGFLAKVLIEK+LR APDVGKI Sbjct: 119 VGMKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKI 163 >KRH71795.1 hypothetical protein GLYMA_02G169100 [Glycine max] Length = 594 Score = 70.9 bits (172), Expect = 2e-12 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +2 Query: 86 YDGGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 YDG +T +G E+G+ IV+FL GKK ITGATGFLAKV IEKILR PDVGK+ Sbjct: 84 YDG-PTTLIGVEDGIGIVKFLGGKKFFITGATGFLAKVFIEKILRTEPDVGKM 135 >KHN00025.1 Fatty acyl-CoA reductase 2 [Glycine soja] Length = 609 Score = 70.9 bits (172), Expect = 2e-12 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +2 Query: 86 YDGGSSTELGPEEGLSIVRFLTGKKLLITGATGFLAKVLIEKILRAAPDVGKI 244 YDG +T +G E+G+ IV+FL GKK ITGATGFLAKV IEKILR PDVGK+ Sbjct: 99 YDG-PTTLIGVEDGIGIVKFLGGKKFFITGATGFLAKVFIEKILRTEPDVGKM 150