BLASTX nr result
ID: Alisma22_contig00016261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00016261 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT47669.1 BTB/POZ domain-containing protein FBL11 [Anthurium am... 69 7e-12 XP_019051487.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051486.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051485.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051484.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051483.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051482.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051481.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051480.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019051479.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 60 9e-09 XP_019158484.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 59 2e-08 XP_019158483.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 59 2e-08 XP_019158482.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 59 2e-08 XP_019158481.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 59 2e-08 XP_010089390.1 hypothetical protein L484_013781 [Morus notabilis... 56 3e-07 XP_008788430.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 53 3e-06 XP_008788422.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 53 3e-06 XP_008788414.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 53 3e-06 KMT06840.1 hypothetical protein BVRB_7g159950 isoform A [Beta vu... 53 3e-06 XP_019106297.1 PREDICTED: BTB/POZ domain-containing protein FBL1... 53 3e-06 >JAT47669.1 BTB/POZ domain-containing protein FBL11 [Anthurium amnicola] Length = 652 Score = 68.9 bits (167), Expect = 7e-12 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHL 176 D+PY LL C++ PDLTV+SEK+LC+ +L WI+ NE S+ S +DY ILEKV + Sbjct: 9 DVPYDLLYSCLEHPDLTVYSEKQLCEALLFWITSNEKSSECSCDTAKDYVSILEKVRV 66 >XP_019051487.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X9 [Nelumbo nucifera] Length = 862 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 31 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 89 Query: 186 IP 191 +P Sbjct: 90 LP 91 >XP_019051486.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X8 [Nelumbo nucifera] Length = 925 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 191 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 249 Query: 186 IP 191 +P Sbjct: 250 LP 251 >XP_019051485.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X7 [Nelumbo nucifera] Length = 940 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 191 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 249 Query: 186 IP 191 +P Sbjct: 250 LP 251 >XP_019051484.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X6 [Nelumbo nucifera] Length = 963 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 191 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 249 Query: 186 IP 191 +P Sbjct: 250 LP 251 >XP_019051483.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X5 [Nelumbo nucifera] Length = 967 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 136 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 194 Query: 186 IP 191 +P Sbjct: 195 LP 196 >XP_019051482.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X4 [Nelumbo nucifera] Length = 971 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 140 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 198 Query: 186 IP 191 +P Sbjct: 199 LP 200 >XP_019051481.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X3 [Nelumbo nucifera] Length = 984 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 191 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 249 Query: 186 IP 191 +P Sbjct: 250 LP 251 >XP_019051480.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Nelumbo nucifera] Length = 999 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 191 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 249 Query: 186 IP 191 +P Sbjct: 250 LP 251 >XP_019051479.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X1 [Nelumbo nucifera] Length = 1022 Score = 60.1 bits (144), Expect = 9e-09 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = +3 Query: 6 IPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHLENY 185 +P+ LL CI+ P LTV SEK LC+ +L W++ N + S+ +DY ILEKV L N Sbjct: 191 VPFNLLCSCIEHPHLTVDSEKHLCEALLGWLTSNVGSMEFSSNTEDDYGSILEKVQL-NL 249 Query: 186 IP 191 +P Sbjct: 250 LP 251 >XP_019158484.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X4 [Ipomoea nil] Length = 823 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKV 170 D+PY++L CI +P+LTV SEK LCD IL W++ N S+ + DY+ IL ++ Sbjct: 40 DVPYEMLYSCIKNPNLTVDSEKHLCDAILAWLTSNTKEYGASSASINDYTDILAEI 95 >XP_019158483.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X3 [Ipomoea nil] Length = 912 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKV 170 D+PY++L CI +P+LTV SEK LCD IL W++ N S+ + DY+ IL ++ Sbjct: 193 DVPYEMLYSCIKNPNLTVDSEKHLCDAILAWLTSNTKEYGASSASINDYTDILAEI 248 >XP_019158482.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Ipomoea nil] Length = 975 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKV 170 D+PY++L CI +P+LTV SEK LCD IL W++ N S+ + DY+ IL ++ Sbjct: 193 DVPYEMLYSCIKNPNLTVDSEKHLCDAILAWLTSNTKEYGASSASINDYTDILAEI 248 >XP_019158481.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X1 [Ipomoea nil] Length = 976 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKV 170 D+PY++L CI +P+LTV SEK LCD IL W++ N S+ + DY+ IL ++ Sbjct: 193 DVPYEMLYSCIKNPNLTVDSEKHLCDAILAWLTSNTKEYGASSASINDYTDILAEI 248 >XP_010089390.1 hypothetical protein L484_013781 [Morus notabilis] EXB37743.1 hypothetical protein L484_013781 [Morus notabilis] Length = 1047 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSDLSTIPLEDYSKILEKVHL 176 DIPY LL CI P LT+ SE LCD +L W+ N SD + +YS IL+++HL Sbjct: 213 DIPYSLLVICIRHPHLTMESEMHLCDALLIWLDANTGDSDGLSSTETNYSSILKQIHL 270 >XP_008788430.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X3 [Phoenix dactylifera] Length = 952 Score = 52.8 bits (125), Expect = 3e-06 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSD-LSTIPLEDYSKILEKVHL 176 DIPY LL +DDP LTV SEK+LC+ L W+S N S+ L I + IL+KV + Sbjct: 190 DIPYSLLHSSLDDPQLTVDSEKQLCEAFLIWLSNNAKCSECLPIISRNNKFDILKKVRI 248 >XP_008788422.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Phoenix dactylifera] Length = 968 Score = 52.8 bits (125), Expect = 3e-06 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSD-LSTIPLEDYSKILEKVHL 176 DIPY LL +DDP LTV SEK+LC+ L W+S N S+ L I + IL+KV + Sbjct: 190 DIPYSLLHSSLDDPQLTVDSEKQLCEAFLIWLSNNAKCSECLPIISRNNKFDILKKVRI 248 >XP_008788414.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X1 [Phoenix dactylifera] Length = 970 Score = 52.8 bits (125), Expect = 3e-06 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKNEMGSD-LSTIPLEDYSKILEKVHL 176 DIPY LL +DDP LTV SEK+LC+ L W+S N S+ L I + IL+KV + Sbjct: 190 DIPYSLLHSSLDDPQLTVDSEKQLCEAFLIWLSNNAKCSECLPIISRNNKFDILKKVRI 248 >KMT06840.1 hypothetical protein BVRB_7g159950 isoform A [Beta vulgaris subsp. vulgaris] Length = 978 Score = 52.8 bits (125), Expect = 3e-06 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 12/75 (16%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKN-----------EMGSDLST-IPLED 146 D+PYQLL C+ PDLTV SE+ LC+ +L W N + GSD S I Sbjct: 197 DLPYQLLVSCVKHPDLTVESERHLCELLLAWFCANMEPLEQTGSAEDGGSDKSKHIATHA 256 Query: 147 YSKILEKVHLENYIP 191 ++ I E++H+ N +P Sbjct: 257 WTSIFEEIHI-NLLP 270 >XP_019106297.1 PREDICTED: BTB/POZ domain-containing protein FBL11 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 999 Score = 52.8 bits (125), Expect = 3e-06 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 12/75 (16%) Frame = +3 Query: 3 DIPYQLLADCIDDPDLTVHSEKELCDTILDWISKN-----------EMGSDLST-IPLED 146 D+PYQLL C+ PDLTV SE+ LC+ +L W N + GSD S I Sbjct: 218 DLPYQLLVSCVKHPDLTVESERHLCELLLAWFCANMEPLEQTGSAEDGGSDKSKHIATHA 277 Query: 147 YSKILEKVHLENYIP 191 ++ I E++H+ N +P Sbjct: 278 WTSIFEEIHI-NLLP 291