BLASTX nr result
ID: Alisma22_contig00015452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00015452 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIU48022.1 glutamate decarboxylase [Dendrobium catenatum] 55 1e-06 XP_011086975.1 PREDICTED: glutamate decarboxylase-like [Sesamum ... 54 2e-06 >AIU48022.1 glutamate decarboxylase [Dendrobium catenatum] Length = 498 Score = 54.7 bits (130), Expect = 1e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 106 MVLVTTKLAEEQSLHCTFASRYVRTSLPRFTIPD 5 MVL TT LA +SL CTFASRYVRTSLPRF +PD Sbjct: 1 MVLTTTNLAAGESLPCTFASRYVRTSLPRFQLPD 34 >XP_011086975.1 PREDICTED: glutamate decarboxylase-like [Sesamum indicum] Length = 500 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -3 Query: 106 MVLVTTKLAEEQSLHCTFASRYVRTSLPRFTIPD 5 MV+ TT A ++ LHCTFASRY RTSLPRF IPD Sbjct: 1 MVVTTTTAASDEHLHCTFASRYARTSLPRFKIPD 34