BLASTX nr result
ID: Alisma22_contig00015202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00015202 (990 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009262790.1 ribosomal protein L22 (chloroplast) [Ludisia disc... 84 3e-16 BAG06617.1 ribosomal protein L22 (chloroplast) [Dendrobium sp. J... 80 5e-15 YP_009179991.1 50S ribosomal protein L22 (chloroplast) [Bletilla... 80 7e-15 YP_009239613.1 ribosomal protein L22 (chloroplast) [Cymbidium la... 80 7e-15 YP_009236241.1 50S ribosomal protein L22 (chloroplast) [Bletilla... 80 7e-15 YP_008081924.1 50S ribosomal protein L22 (chloroplast) [Cymbidiu... 80 7e-15 YP_008081690.1 50S ribosomal protein L22 (chloroplast) [Cymbidiu... 80 7e-15 AKJ83557.1 ribosomal protein L22 (chloroplast) [Alocasia macrorr... 80 7e-15 YP_009161867.1 ribosomal protein L22 (chloroplast) [Dendrobium s... 80 8e-15 YP_009048239.1 50S ribosomal protein L22 (chloroplast) [Calanthe... 80 8e-15 YP_009026477.1 ribosomal protein L22 (chloroplast) [Dendrobium c... 80 8e-15 YP_009235479.1 ribosomal protein L22 (chloroplast) [Dendrobium n... 80 8e-15 AHH24313.1 ribosomal protein L22 (chloroplast) [Japonolirion ose... 79 9e-15 YP_009184090.1 ribosomal protein L22 (chloroplast) [Dendrobium c... 79 9e-15 YP_009239688.1 ribosomal protein L22 (chloroplast) [Cymbidium ma... 79 1e-14 AEZ01464.1 ribosomal protein L22 (chloroplast) [Japonolirion ose... 79 1e-14 YP_009175310.1 ribosomal protein L22 (chloroplast) [Phragmipediu... 79 1e-14 YP_009241871.1 ribosomal protein L22 (plastid) [Potamogeton perf... 79 1e-14 BAG06632.1 ribosomal protein L22 (chloroplast) [Potamogeton cris... 79 1e-14 BAG06407.1 ribosomal protein L22 (chloroplast) [Alisma canalicul... 79 1e-14 >YP_009262790.1 ribosomal protein L22 (chloroplast) [Ludisia discolor] ANI87454.1 ribosomal protein L22 (chloroplast) [Ludisia discolor] Length = 125 Score = 83.6 bits (205), Expect = 3e-16 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = +1 Query: 562 IMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNMALSEADLFIIKAK 729 ++D I GCSY ETLMILELMPY ASYP LKLVY AAANAS NM L+EADLFI KA+ Sbjct: 31 VIDQIRGCSYEETLMILELMPYRASYPILKLVYSAAANASNNMGLNEADLFISKAE 86 >BAG06617.1 ribosomal protein L22 (chloroplast) [Dendrobium sp. JLB71] Length = 121 Score = 80.1 bits (196), Expect = 5e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHICMSVFKARRII-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_009179991.1 50S ribosomal protein L22 (chloroplast) [Bletilla striata] ALL53037.1 50S ribosomal protein L22 (chloroplast) [Bletilla striata] Length = 118 Score = 79.7 bits (195), Expect = 7e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_009239613.1 ribosomal protein L22 (chloroplast) [Cymbidium lancifolium] AMM05888.1 ribosomal protein L22 (chloroplast) [Cymbidium lancifolium] Length = 119 Score = 79.7 bits (195), Expect = 7e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHIYMSVFKARRVI-DQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_009236241.1 50S ribosomal protein L22 (chloroplast) [Bletilla ochracea] AMF83948.1 50S ribosomal protein L22 (chloroplast) [Bletilla ochracea] Length = 119 Score = 79.7 bits (195), Expect = 7e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHIYMSVFKARRVI-DQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_008081924.1 50S ribosomal protein L22 (chloroplast) [Cymbidium mannii] YP_008081612.1 50S ribosomal protein L22 (chloroplast) [Cymbidium aloifolium] AGK25278.1 50S ribosomal protein L22 (chloroplast) [Cymbidium aloifolium] AGK25590.1 50S ribosomal protein L22 (chloroplast) [Cymbidium mannii] AGK25824.1 50S ribosomal protein L22 (chloroplast) [Cymbidium mannii] Length = 119 Score = 79.7 bits (195), Expect = 7e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHIYMSVFKARRVI-DQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_008081690.1 50S ribosomal protein L22 (chloroplast) [Cymbidium sinense] YP_008081846.1 50S ribosomal protein L22 (chloroplast) [Cymbidium tracyanum] YP_008081768.1 50S ribosomal protein L22 (chloroplast) [Cymbidium tortisepalum] YP_009163440.1 50S ribosomal protein L22 (chloroplast) [Cymbidium faberi] YP_009183321.1 50S ribosomal protein L22 (chloroplast) [Cymbidium goeringii] YP_009239536.1 ribosomal protein L22 (chloroplast) [Cymbidium kanran] BAG06432.1 ribosomal protein L22 (chloroplast) [Cymbidium sinense] AGK25356.1 50S ribosomal protein L22 (chloroplast) [Cymbidium sinense] AGK25434.1 50S ribosomal protein L22 (chloroplast) [Cymbidium tortisepalum] AGK25512.1 50S ribosomal protein L22 (chloroplast) [Cymbidium tortisepalum] AGK25668.1 50S ribosomal protein L22 (chloroplast) [Cymbidium tracyanum] AGK25746.1 50S ribosomal protein L22 (chloroplast) [Cymbidium tortisepalum] AKU70900.1 50S ribosomal protein L22 (chloroplast) [Cymbidium faberi] ALM87834.1 50S ribosomal protein L22 (chloroplast) [Cymbidium goeringii] AMM05740.1 ribosomal protein L22 (chloroplast) [Cymbidium ensifolium] AMM05811.1 ribosomal protein L22 (chloroplast) [Cymbidium kanran] Length = 119 Score = 79.7 bits (195), Expect = 7e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHIYMSVFKARRVI-DQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >AKJ83557.1 ribosomal protein L22 (chloroplast) [Alocasia macrorrhizos] Length = 120 Score = 79.7 bits (195), Expect = 7e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 10 AKVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHN 68 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 69 MGLNEADLFISKAE 82 >YP_009161867.1 ribosomal protein L22 (chloroplast) [Dendrobium strongylanthum] YP_009180228.1 ribosomal protein L22 (chloroplast) [Dendrobium huoshanense] YP_009239391.1 ribosomal protein L22 (chloroplast) [Dendrobium pendulum] AKS28626.1 ribosomal protein L22 (chloroplast) [Dendrobium strongylanthum] ALG65746.1 ribosomal protein L22 (chloroplast) [Anoectochilus roxburghii] ALL96590.1 ribosomal protein L22 (chloroplast) [Dendrobium huoshanense] AMM05350.1 ribosomal protein L22 (chloroplast) [Dendrobium pendulum] BAV37832.1 50S ribosomal protein L22 (chloroplast) [Dendrobium nobile] Length = 121 Score = 79.7 bits (195), Expect = 8e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_009048239.1 50S ribosomal protein L22 (chloroplast) [Calanthe triplicata] AHF71868.1 50S ribosomal protein L22 (chloroplast) [Calanthe triplicata] Length = 121 Score = 79.7 bits (195), Expect = 8e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_009026477.1 ribosomal protein L22 (chloroplast) [Dendrobium catenatum] AGM48235.1 ribosomal protein L22 (chloroplast) [Dendrobium catenatum] AIR76448.1 ribosomal protein L22 (chloroplast) [Dendrobium catenatum] AOW68546.1 ribosomal protein L22 (chloroplast) [Dendrobium catenatum] Length = 121 Score = 79.7 bits (195), Expect = 8e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 11 AKVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHN 69 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 70 MGLNEADLFISKAE 83 >YP_009235479.1 ribosomal protein L22 (chloroplast) [Dendrobium nobile] AMD15604.1 ribosomal protein L22 (chloroplast) [Dendrobium nobile] Length = 123 Score = 79.7 bits (195), Expect = 8e-15 Identities = 46/74 (62%), Positives = 54/74 (72%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCN 687 +K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS N Sbjct: 13 AKVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHN 71 Query: 688 MALSEADLFIIKAK 729 M L+EADLFI KA+ Sbjct: 72 MGLNEADLFISKAE 85 >AHH24313.1 ribosomal protein L22 (chloroplast) [Japonolirion osense] Length = 101 Score = 79.0 bits (193), Expect = 9e-15 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = +1 Query: 562 IMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNMALSEADLFIIKAK 729 ++D I G SY ETLMILELMPY ASYP LKLVY AAANAS NM L+EADLFI KA+ Sbjct: 9 VIDQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHNMGLNEADLFISKAE 64 >YP_009184090.1 ribosomal protein L22 (chloroplast) [Dendrobium chrysotoxum] ALN98142.1 ribosomal protein L22 (chloroplast) [Dendrobium chrysotoxum] Length = 103 Score = 79.0 bits (193), Expect = 9e-15 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = +1 Query: 562 IMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNMALSEADLFIIKAK 729 ++D I G SY ETLMILELMPY ASYP LKLVY AAANAS NM L+EADLFI KA+ Sbjct: 13 VIDQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHNMGLNEADLFISKAE 68 >YP_009239688.1 ribosomal protein L22 (chloroplast) [Cymbidium macrorhizon] AMM05962.1 ribosomal protein L22 (chloroplast) [Cymbidium macrorhizon] Length = 119 Score = 79.3 bits (194), Expect = 1e-14 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 1/75 (1%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSL-IMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASC 684 +K++ Q+ +Y+ F + ++D I G SY ETLMILELMPY ASYP LKLVY AAANAS Sbjct: 11 AKVLAQH--IYMSAFKARRVIDQIRGRSYEETLMILELMPYWASYPILKLVYSAAANASH 68 Query: 685 NMALSEADLFIIKAK 729 NM L+EADLFI KA+ Sbjct: 69 NMGLNEADLFISKAE 83 >AEZ01464.1 ribosomal protein L22 (chloroplast) [Japonolirion osense] Length = 120 Score = 79.3 bits (194), Expect = 1e-14 Identities = 46/73 (63%), Positives = 53/73 (72%) Frame = +1 Query: 511 KMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNM 690 K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS NM Sbjct: 12 KVLAQHICMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHNM 70 Query: 691 ALSEADLFIIKAK 729 L+EADLFI KA+ Sbjct: 71 GLNEADLFISKAE 83 >YP_009175310.1 ribosomal protein L22 (chloroplast) [Phragmipedium longifolium] AIS67565.1 ribosomal protein L22 (chloroplast) [Phragmipedium longifolium] Length = 121 Score = 79.3 bits (194), Expect = 1e-14 Identities = 45/75 (60%), Positives = 56/75 (74%), Gaps = 1/75 (1%) Frame = +1 Query: 508 SKMIVQNFVLYVHHFHSL-IMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASC 684 +K++ Q+ + + F + ++D I G SY ETLMILELMPY ASYP LKLVY AAANAS Sbjct: 11 AKVLAQHISVCMSVFKARRVIDQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASH 70 Query: 685 NMALSEADLFIIKAK 729 NM L+EADLFI KA+ Sbjct: 71 NMGLNEADLFISKAE 85 >YP_009241871.1 ribosomal protein L22 (plastid) [Potamogeton perfoliatus] AMQ13446.1 ribosomal protein L22 (plastid) [Potamogeton perfoliatus] Length = 122 Score = 79.3 bits (194), Expect = 1e-14 Identities = 46/73 (63%), Positives = 53/73 (72%) Frame = +1 Query: 511 KMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNM 690 K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS NM Sbjct: 14 KVLAQHIYMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHNM 72 Query: 691 ALSEADLFIIKAK 729 L+EADLFI KA+ Sbjct: 73 GLNEADLFISKAE 85 >BAG06632.1 ribosomal protein L22 (chloroplast) [Potamogeton crispus] Length = 122 Score = 79.3 bits (194), Expect = 1e-14 Identities = 46/73 (63%), Positives = 53/73 (72%) Frame = +1 Query: 511 KMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNM 690 K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS NM Sbjct: 14 KVLAQHIYMSVFKARRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHNM 72 Query: 691 ALSEADLFIIKAK 729 L+EADLFI KA+ Sbjct: 73 GLNEADLFISKAE 85 >BAG06407.1 ribosomal protein L22 (chloroplast) [Alisma canaliculatum] Length = 122 Score = 79.3 bits (194), Expect = 1e-14 Identities = 46/73 (63%), Positives = 53/73 (72%) Frame = +1 Query: 511 KMIVQNFVLYVHHFHSLIMDPICGCSYAETLMILELMPY*ASYPTLKLVYLAAANASCNM 690 K++ Q+ + V +I D I G SY ETLMILELMPY ASYP LKLVY AAANAS NM Sbjct: 14 KVLAQHIYMSVFKAQRVI-DQIRGRSYEETLMILELMPYRASYPILKLVYSAAANASHNM 72 Query: 691 ALSEADLFIIKAK 729 L+EADLFI KA+ Sbjct: 73 GLNEADLFISKAE 85