BLASTX nr result
ID: Alisma22_contig00015097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00015097 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009419669.1 PREDICTED: uncharacterized protein LOC103999603 [... 55 2e-06 XP_002879225.1 zinc finger family protein [Arabidopsis lyrata su... 55 3e-06 KZV27495.1 hypothetical protein F511_28193 [Dorcoceras hygrometr... 54 6e-06 >XP_009419669.1 PREDICTED: uncharacterized protein LOC103999603 [Musa acuminata subsp. malaccensis] Length = 371 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = -2 Query: 149 GDGVRTDDED---GFDSAVVSSNAGGGA--QDQLLVFNPRAVLPCFVILYSA 9 G G ++E+ GFDS V + GGGA +D+LLV++PRAVLPCFV++Y+A Sbjct: 320 GHGEAAEEEEKGAGFDSVVPNGGGGGGAVGEDELLVYSPRAVLPCFVVIYTA 371 >XP_002879225.1 zinc finger family protein [Arabidopsis lyrata subsp. lyrata] EFH55484.1 zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 373 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/52 (55%), Positives = 33/52 (63%), Gaps = 5/52 (9%) Frame = -2 Query: 152 DGDGVRTDDEDGFDSAVVSSNAGGGA-----QDQLLVFNPRAVLPCFVILYS 12 DGD V D G+DS V S GA D+LLVFNPRAVLPCFVI+Y+ Sbjct: 321 DGDDVEKSDGGGYDSLVGQSGNKSGALLRFDDDELLVFNPRAVLPCFVIVYT 372 >KZV27495.1 hypothetical protein F511_28193 [Dorcoceras hygrometricum] Length = 340 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -2 Query: 155 GDGDGVRTDDEDGFDSAVVSSNAGGGAQDQLLVFNPRAVLPCFVILYSA 9 G G+ ++ GFDS V GG +++LLVFNPRAVLPCFVI+Y+A Sbjct: 294 GCDPGIVDKEDSGFDSLV--GRGSGGFEEELLVFNPRAVLPCFVIVYTA 340