BLASTX nr result
ID: Alisma22_contig00014964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00014964 (568 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008811532.1 PREDICTED: molybdopterin synthase sulfur carrier ... 96 2e-22 XP_008811535.1 PREDICTED: molybdopterin synthase sulfur carrier ... 94 1e-21 XP_008811531.1 PREDICTED: molybdopterin synthase sulfur carrier ... 94 1e-21 XP_008811534.1 PREDICTED: molybdopterin synthase sulfur carrier ... 94 1e-21 XP_020110552.1 molybdopterin synthase sulfur carrier subunit-lik... 91 3e-20 XP_003575158.1 PREDICTED: molybdopterin synthase sulfur carrier ... 90 3e-20 NP_001148029.1 molybdopterin synthase sulfur carrier subunit [Ze... 90 3e-20 XP_018730829.1 PREDICTED: molybdopterin synthase sulfur carrier ... 90 5e-20 B6SXF8.1 RecName: Full=Molybdopterin synthase sulfur carrier sub... 89 1e-19 XP_012854939.1 PREDICTED: molybdopterin synthase sulfur carrier ... 88 1e-19 XP_006288974.1 hypothetical protein CARUB_v10002348mg [Capsella ... 88 1e-19 XP_006857860.1 PREDICTED: molybdopterin synthase sulfur carrier ... 88 2e-19 NP_567352.1 co-factor for nitrate, reductase and xanthine dehydr... 88 2e-19 XP_010914686.1 PREDICTED: molybdopterin synthase sulfur carrier ... 89 3e-19 XP_019090135.1 PREDICTED: molybdopterin synthase sulfur carrier ... 87 4e-19 XP_019089843.1 PREDICTED: molybdopterin synthase sulfur carrier ... 87 7e-19 ONK77306.1 uncharacterized protein A4U43_C02F5180 [Asparagus off... 87 8e-19 XP_009415011.1 PREDICTED: molybdopterin synthase sulfur carrier ... 86 1e-18 XP_018686453.1 PREDICTED: molybdopterin synthase sulfur carrier ... 86 1e-18 XP_010687616.1 PREDICTED: molybdopterin synthase sulfur carrier ... 86 2e-18 >XP_008811532.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X2 [Phoenix dactylifera] Length = 121 Score = 96.3 bits (238), Expect = 2e-22 Identities = 50/88 (56%), Positives = 60/88 (68%) Frame = +3 Query: 36 PDSTTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALE 215 P T+ + + E P I++KVLFFARAR+LTG D SL MPP ST C+ LL KF LE Sbjct: 26 PKKTSDMAEMEVGPLIQVKVLFFARARELTGLTDISLLMPPRSTARDCMSKLLNKFPKLE 85 Query: 216 EIRHVCVVAVNEEYAEESRILDNGDELA 299 EI + VVA+NEEYA ES +L N DELA Sbjct: 86 EIYNSMVVALNEEYAPESTVLRNSDELA 113 >XP_008811535.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X4 [Phoenix dactylifera] Length = 105 Score = 94.0 bits (232), Expect = 1e-21 Identities = 49/85 (57%), Positives = 59/85 (69%) Frame = +3 Query: 45 TTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIR 224 T+ + + E P I++KVLFFARAR+LTG D SL MPP ST C+ LL KF LEEI Sbjct: 13 TSDMAEMEVGPLIQVKVLFFARARELTGLTDISLLMPPRSTARDCMSKLLNKFPKLEEIY 72 Query: 225 HVCVVAVNEEYAEESRILDNGDELA 299 + VVA+NEEYA ES +L N DELA Sbjct: 73 NSMVVALNEEYAPESTVLRNSDELA 97 >XP_008811531.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X1 [Phoenix dactylifera] Length = 123 Score = 94.4 bits (233), Expect = 1e-21 Identities = 50/93 (53%), Positives = 60/93 (64%) Frame = +3 Query: 21 QSGDPPDSTTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTK 200 Q T+ + + E P I++KVLFFARAR+LTG D SL MPP ST C+ LL K Sbjct: 23 QKNPKMQKTSDMAEMEVGPLIQVKVLFFARARELTGLTDISLLMPPRSTARDCMSKLLNK 82 Query: 201 FTALEEIRHVCVVAVNEEYAEESRILDNGDELA 299 F LEEI + VVA+NEEYA ES +L N DELA Sbjct: 83 FPKLEEIYNSMVVALNEEYAPESTVLRNSDELA 115 >XP_008811534.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X3 [Phoenix dactylifera] Length = 115 Score = 94.0 bits (232), Expect = 1e-21 Identities = 49/85 (57%), Positives = 59/85 (69%) Frame = +3 Query: 45 TTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIR 224 T+ + + E P I++KVLFFARAR+LTG D SL MPP ST C+ LL KF LEEI Sbjct: 23 TSDMAEMEVGPLIQVKVLFFARARELTGLTDISLLMPPRSTARDCMSKLLNKFPKLEEIY 82 Query: 225 HVCVVAVNEEYAEESRILDNGDELA 299 + VVA+NEEYA ES +L N DELA Sbjct: 83 NSMVVALNEEYAPESTVLRNSDELA 107 >XP_020110552.1 molybdopterin synthase sulfur carrier subunit-like [Ananas comosus] Length = 134 Score = 91.3 bits (225), Expect = 3e-20 Identities = 46/74 (62%), Positives = 57/74 (77%) Frame = +3 Query: 78 TIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVVAVNEEY 257 +IEIKVLFFARARDLTG ++ S+++P GST C+ LLTKF LEEI + V+A+NEEY Sbjct: 53 SIEIKVLFFARARDLTGLSETSIELPEGSTAGDCMSKLLTKFPNLEEISNSMVLALNEEY 112 Query: 258 AEESRILDNGDELA 299 A ES +L N DELA Sbjct: 113 APESTVLKNRDELA 126 >XP_003575158.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Brachypodium distachyon] KQJ99911.1 hypothetical protein BRADI_3g45977 [Brachypodium distachyon] Length = 105 Score = 90.1 bits (222), Expect = 3e-20 Identities = 45/86 (52%), Positives = 60/86 (69%) Frame = +3 Query: 42 STTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEI 221 +T + E+ T+ +KVLFFARARDLTG A+ S+++PPGST C+ +L F LEEI Sbjct: 12 ATGSVPAAETAATVRVKVLFFARARDLTGVAESSVEVPPGSTAGACLGQVLASFPKLEEI 71 Query: 222 RHVCVVAVNEEYAEESRILDNGDELA 299 R V+A+NEEYA ES + +GDELA Sbjct: 72 RRSMVLALNEEYAPESAAVADGDELA 97 >NP_001148029.1 molybdopterin synthase sulfur carrier subunit [Zea mays] XP_008643630.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X1 [Zea mays] ABB96257.1 VP15 [Zea mays] ACG29510.1 VP15 [Zea mays] ACG32695.1 VP15 [Zea mays] AQK71806.1 Molybdopterin synthase sulfur carrier subunit [Zea mays] AQK71807.1 Molybdopterin synthase sulfur carrier subunit [Zea mays] Length = 106 Score = 90.1 bits (222), Expect = 3e-20 Identities = 43/89 (48%), Positives = 61/89 (68%) Frame = +3 Query: 33 PPDSTTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTAL 212 P + + ++ P +KVLFFARARDLTG AD ++++PPGST +C+ +L +F L Sbjct: 10 PEEEMPAAAEEQAAPAATVKVLFFARARDLTGVADSAVEVPPGSTAGECLARVLAQFPKL 69 Query: 213 EEIRHVCVVAVNEEYAEESRILDNGDELA 299 EEIR V+A+NEEYA +S + +GDELA Sbjct: 70 EEIRGSVVLALNEEYAADSAAVADGDELA 98 >XP_018730829.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Eucalyptus grandis] KCW69495.1 hypothetical protein EUGRSUZ_F02944 [Eucalyptus grandis] Length = 105 Score = 89.7 bits (221), Expect = 5e-20 Identities = 45/87 (51%), Positives = 59/87 (67%) Frame = +3 Query: 39 DSTTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEE 218 DST I + E ++ IKVLFFARARDLTG +D L++P GST + C+ L +F LEE Sbjct: 11 DSTQGIPKKEEGSSVGIKVLFFARARDLTGLSDVHLEVPSGSTASDCLNELAVRFPGLEE 70 Query: 219 IRHVCVVAVNEEYAEESRILDNGDELA 299 IR V+A+NEEYA E+ ++ DELA Sbjct: 71 IRQCIVLALNEEYASETTVIKENDELA 97 >B6SXF8.1 RecName: Full=Molybdopterin synthase sulfur carrier subunit; AltName: Full=Molybdenum cofactor synthesis protein 2 small subunit; AltName: Full=Molybdenum cofactor synthesis protein 2A; Short=MOCS2A; AltName: Full=Protein viviparous15; AltName: Full=Sulfur carrier protein MOCS2A ACG29541.1 VP15 [Zea mays] Length = 93 Score = 88.6 bits (218), Expect = 1e-19 Identities = 42/80 (52%), Positives = 59/80 (73%) Frame = +3 Query: 60 QPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVV 239 + ++ P +KVLFFARARDLTG AD ++++PPGST +C+ +L +F LEEIR V+ Sbjct: 6 EEQAAPAATVKVLFFARARDLTGVADSAVEVPPGSTAGECLARVLAQFPKLEEIRGSVVL 65 Query: 240 AVNEEYAEESRILDNGDELA 299 A+NEEYA +S + +GDELA Sbjct: 66 ALNEEYAADSAAVADGDELA 85 >XP_012854939.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Erythranthe guttata] EYU22713.1 hypothetical protein MIMGU_mgv1a024016mg [Erythranthe guttata] Length = 91 Score = 88.2 bits (217), Expect = 1e-19 Identities = 43/80 (53%), Positives = 59/80 (73%) Frame = +3 Query: 60 QPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVV 239 + E + +I+IKVLFFARARDLTG D SL++ PG+T C+ ++TKF LEEIR+ V+ Sbjct: 4 EKEERISIKIKVLFFARARDLTGMTDMSLEVSPGTTALGCLDKVITKFPGLEEIRNCMVL 63 Query: 240 AVNEEYAEESRILDNGDELA 299 A+NEEY ES ++ + DELA Sbjct: 64 ALNEEYTPESTVVKDRDELA 83 >XP_006288974.1 hypothetical protein CARUB_v10002348mg [Capsella rubella] EOA21872.1 hypothetical protein CARUB_v10002348mg [Capsella rubella] Length = 91 Score = 88.2 bits (217), Expect = 1e-19 Identities = 42/74 (56%), Positives = 55/74 (74%) Frame = +3 Query: 78 TIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVVAVNEEY 257 T+EIKVL FARARDLTG D +LKMP GST +C+ L+ KF +LEE+R V+A+NEEY Sbjct: 10 TVEIKVLLFARARDLTGVPDLTLKMPSGSTTKKCMDELVLKFPSLEEVRSCVVLALNEEY 69 Query: 258 AEESRILDNGDELA 299 +S ++ + DELA Sbjct: 70 TTDSAVVQHRDELA 83 >XP_006857860.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Amborella trichopoda] ERN19327.1 hypothetical protein AMTR_s00069p00080060 [Amborella trichopoda] Length = 105 Score = 88.2 bits (217), Expect = 2e-19 Identities = 44/78 (56%), Positives = 56/78 (71%) Frame = +3 Query: 66 ESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVVAV 245 ES P+IE+KVLFFARARDLTG +L + PG T +C+ LL KF +L EI+ +A+ Sbjct: 20 ESLPSIELKVLFFARARDLTGLTHTALSVKPGCTALECVIELLAKFPSLREIKDCMALAL 79 Query: 246 NEEYAEESRILDNGDELA 299 NEEYA E+ I+ NGDELA Sbjct: 80 NEEYAPETTIVKNGDELA 97 >NP_567352.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7 [Arabidopsis thaliana] NP_849354.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7 [Arabidopsis thaliana] NP_001078366.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7 [Arabidopsis thaliana] Q9S7A3.1 RecName: Full=Molybdopterin synthase sulfur carrier subunit; AltName: Full=Molybdenum cofactor synthesis protein 2 small subunit; AltName: Full=Molybdenum cofactor synthesis protein 2A; Short=MOCS2A; AltName: Full=Sulfur carrier protein MOCS2A AAF19969.1 molybdopterin synthase small subunit [Arabidopsis thaliana] CAB39762.1 hypothetical protein [Arabidopsis thaliana] CAB78133.1 hypothetical protein [Arabidopsis thaliana] AAM65028.1 unknown [Arabidopsis thaliana] BAC42352.1 unknown protein [Arabidopsis thaliana] ABD38884.1 At4g10100 [Arabidopsis thaliana] BAH20148.1 AT4G10100 [Arabidopsis thaliana] AEE82838.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7 [Arabidopsis thaliana] AEE82839.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7 [Arabidopsis thaliana] AEE82840.1 co-factor for nitrate, reductase and xanthine dehydrogenase 7 [Arabidopsis thaliana] OAO96655.1 SIR5 [Arabidopsis thaliana] Length = 96 Score = 87.8 bits (216), Expect = 2e-19 Identities = 42/87 (48%), Positives = 59/87 (67%) Frame = +3 Query: 39 DSTTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEE 218 D ++ + ++EIKVL FARAR+LTG D +LKMP GST +C+ L+ KF +LEE Sbjct: 2 DKEVTKIESDDTSSVEIKVLLFARARELTGVPDLTLKMPSGSTTQKCLDELVLKFPSLEE 61 Query: 219 IRHVCVVAVNEEYAEESRILDNGDELA 299 +R V+A+NEEY +S I+ + DELA Sbjct: 62 VRSCVVLALNEEYTTDSAIVQHRDELA 88 >XP_010914686.1 PREDICTED: molybdopterin synthase sulfur carrier subunit-like [Elaeis guineensis] Length = 130 Score = 88.6 bits (218), Expect = 3e-19 Identities = 47/85 (55%), Positives = 57/85 (67%) Frame = +3 Query: 45 TTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIR 224 T+ + + E P IE+KVLFFARAR+LTG D SL MPP ST C+ LL F LEEI Sbjct: 38 TSDMEEREVGPWIEVKVLFFARARELTGLTDISLLMPPQSTARDCMSKLLNNFPKLEEIY 97 Query: 225 HVCVVAVNEEYAEESRILDNGDELA 299 + V+A+NEEY ES +L N DELA Sbjct: 98 NSMVLALNEEYVPESTVLRNRDELA 122 >XP_019090135.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Camelina sativa] Length = 96 Score = 87.0 bits (214), Expect = 4e-19 Identities = 42/87 (48%), Positives = 59/87 (67%) Frame = +3 Query: 39 DSTTLIVQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEE 218 D ++ + ++EIKVL FARAR+LTG D +LKMP GST +C+ L+ KF +LEE Sbjct: 2 DKEVTKIESDDTSSVEIKVLLFARARELTGVPDLTLKMPSGSTTQKCMDELVLKFPSLEE 61 Query: 219 IRHVCVVAVNEEYAEESRILDNGDELA 299 +R V+A+NEEY +S I+ + DELA Sbjct: 62 VRGCVVLALNEEYTTDSAIVQHRDELA 88 >XP_019089843.1 PREDICTED: molybdopterin synthase sulfur carrier subunit-like [Camelina sativa] Length = 102 Score = 86.7 bits (213), Expect = 7e-19 Identities = 42/81 (51%), Positives = 57/81 (70%) Frame = +3 Query: 57 VQPESQPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCV 236 ++ + T+EIKVL FARAR+LTG D +LKMP GST +C+ L+ KF +LEE+R V Sbjct: 14 IEGDDTSTVEIKVLLFARARELTGVPDLTLKMPSGSTTQKCMDELVLKFPSLEEVRSCVV 73 Query: 237 VAVNEEYAEESRILDNGDELA 299 +A+NEEY S I+ + DELA Sbjct: 74 LALNEEYTTGSAIVQHRDELA 94 >ONK77306.1 uncharacterized protein A4U43_C02F5180 [Asparagus officinalis] Length = 106 Score = 86.7 bits (213), Expect = 8e-19 Identities = 44/73 (60%), Positives = 53/73 (72%) Frame = +3 Query: 81 IEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVVAVNEEYA 260 IEIKVLFFARARDLTG + LK+P GST C+ LLT+F L EI + V+A+NEEYA Sbjct: 26 IEIKVLFFARARDLTGSKEIPLKLPAGSTAGDCMSKLLTQFPQLGEIYNSVVLALNEEYA 85 Query: 261 EESRILDNGDELA 299 E+ +L N DELA Sbjct: 86 PETAVLKNKDELA 98 >XP_009415011.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X1 [Musa acuminata subsp. malaccensis] Length = 109 Score = 86.3 bits (212), Expect = 1e-18 Identities = 47/98 (47%), Positives = 62/98 (63%), Gaps = 8/98 (8%) Frame = +3 Query: 30 DPPDSTTLIVQPESQPT--------IEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQ 185 +P D+ +I ++ P+ I+IKVLFFARARDLTG + L+MP GST C+ Sbjct: 4 EPKDTCDMIGSQKTNPSRDKDLAPYIKIKVLFFARARDLTGSTELCLEMPDGSTARDCMN 63 Query: 186 ALLTKFTALEEIRHVCVVAVNEEYAEESRILDNGDELA 299 LL +F L EI + V+A+NEEYA ES +L N DELA Sbjct: 64 KLLIEFPNLREIYNSMVLALNEEYAPESTVLRNKDELA 101 >XP_018686453.1 PREDICTED: molybdopterin synthase sulfur carrier subunit isoform X2 [Musa acuminata subsp. malaccensis] Length = 99 Score = 85.9 bits (211), Expect = 1e-18 Identities = 44/75 (58%), Positives = 53/75 (70%) Frame = +3 Query: 75 PTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVVAVNEE 254 P I+IKVLFFARARDLTG + L+MP GST C+ LL +F L EI + V+A+NEE Sbjct: 17 PYIKIKVLFFARARDLTGSTELCLEMPDGSTARDCMNKLLIEFPNLREIYNSMVLALNEE 76 Query: 255 YAEESRILDNGDELA 299 YA ES +L N DELA Sbjct: 77 YAPESTVLRNKDELA 91 >XP_010687616.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Beta vulgaris subsp. vulgaris] XP_010687617.1 PREDICTED: molybdopterin synthase sulfur carrier subunit [Beta vulgaris subsp. vulgaris] KMT03450.1 hypothetical protein BVRB_8g191340 [Beta vulgaris subsp. vulgaris] Length = 102 Score = 85.5 bits (210), Expect = 2e-18 Identities = 41/76 (53%), Positives = 56/76 (73%) Frame = +3 Query: 72 QPTIEIKVLFFARARDLTGKADFSLKMPPGSTVNQCIQALLTKFTALEEIRHVCVVAVNE 251 + +IE+KVLFFARARDLTG AD L++ GST C+ ++T+F LE+IR V+A+NE Sbjct: 19 ESSIELKVLFFARARDLTGLADMPLEVTSGSTARDCLDKIVTRFPGLEDIRGCMVLALNE 78 Query: 252 EYAEESRILDNGDELA 299 EYA ES ++ + DELA Sbjct: 79 EYASESAVVKHRDELA 94