BLASTX nr result
ID: Alisma22_contig00014715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00014715 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO61179.1 hypothetical protein CISIN_1g003278mg [Citrus sinensis] 55 3e-06 XP_006493814.1 PREDICTED: receptor like protein kinase S.2 [Citr... 55 3e-06 XP_006420905.1 hypothetical protein CICLE_v10004317mg [Citrus cl... 55 3e-06 >KDO61179.1 hypothetical protein CISIN_1g003278mg [Citrus sinensis] Length = 834 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/61 (49%), Positives = 36/61 (59%) Frame = -3 Query: 184 WPCPCSTVSIREDSVHDESFHDMPGPYGRQDAATGYDGHRTFSYAELYIGSNGFSEEELL 5 W C C + R++ H FHDM G + G D R FSYAELYIGSNGF E+E+L Sbjct: 64 WVCFCHHNTPRKE--HSGLFHDMEGV--QMSEKVGGDNPRIFSYAELYIGSNGFDEDEVL 119 Query: 4 G 2 G Sbjct: 120 G 120 >XP_006493814.1 PREDICTED: receptor like protein kinase S.2 [Citrus sinensis] Length = 834 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/61 (49%), Positives = 36/61 (59%) Frame = -3 Query: 184 WPCPCSTVSIREDSVHDESFHDMPGPYGRQDAATGYDGHRTFSYAELYIGSNGFSEEELL 5 W C C + R++ H FHDM G + G D R FSYAELYIGSNGF E+E+L Sbjct: 64 WVCFCHHNTPRKE--HSGLFHDMEGV--QMSEKVGGDNPRIFSYAELYIGSNGFDEDEVL 119 Query: 4 G 2 G Sbjct: 120 G 120 >XP_006420905.1 hypothetical protein CICLE_v10004317mg [Citrus clementina] ESR34145.1 hypothetical protein CICLE_v10004317mg [Citrus clementina] Length = 834 Score = 55.1 bits (131), Expect = 3e-06 Identities = 30/61 (49%), Positives = 36/61 (59%) Frame = -3 Query: 184 WPCPCSTVSIREDSVHDESFHDMPGPYGRQDAATGYDGHRTFSYAELYIGSNGFSEEELL 5 W C C + R++ H FHDM G + G D R FSYAELYIGSNGF E+E+L Sbjct: 64 WVCFCHHNTPRKE--HSGLFHDMEGV--QMSEKVGGDNPRIFSYAELYIGSNGFDEDEVL 119 Query: 4 G 2 G Sbjct: 120 G 120