BLASTX nr result
ID: Alisma22_contig00014615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00014615 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236465.1 PREDICTED: uncharacterized protein LOC108209833 [... 54 3e-06 JAT48248.1 Pericentrin [Anthurium amnicola] 53 9e-06 >XP_017236465.1 PREDICTED: uncharacterized protein LOC108209833 [Daucus carota subsp. sativus] KZN06089.1 hypothetical protein DCAR_006926 [Daucus carota subsp. sativus] Length = 153 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/55 (41%), Positives = 39/55 (70%) Frame = +2 Query: 56 DQEVLEKLQKFKLLISNNAEALPNLLKRVRECISRVDQISDSTLNIPSCFKKQQT 220 ++E EK+Q K +SNNA A+PN+LKR+ +CISR+D++ +I FK++++ Sbjct: 98 EKEYAEKIQLLKQKLSNNASAMPNVLKRMEDCISRIDKLDSYNGDIHPAFKRKRS 152 >JAT48248.1 Pericentrin [Anthurium amnicola] Length = 173 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/62 (37%), Positives = 38/62 (61%) Frame = +2 Query: 38 SSIDGVDQEVLEKLQKFKLLISNNAEALPNLLKRVRECISRVDQISDSTLNIPSCFKKQQ 217 +S G DQE+ E+L F+ IS N + +PN+LKR+ CI+R+ + + I FKK++ Sbjct: 112 ASFPGTDQEMHERLDIFRAKISRNIDTMPNILKRINGCIARIKSLDQCGIEIHPVFKKRR 171 Query: 218 TL 223 + Sbjct: 172 KI 173