BLASTX nr result
ID: Alisma22_contig00014252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00014252 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT47805.1 putative aminotransferase AF_1815, partial [Anthurium... 52 5e-06 >JAT47805.1 putative aminotransferase AF_1815, partial [Anthurium amnicola] Length = 228 Score = 52.0 bits (123), Expect = 5e-06 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = -2 Query: 145 TPTPTISGGRRPHSGTIVMALPLQSSGMLSPEQLLHLFRRFSELTSLP 2 TP PT R S LQSSGMLS EQLLHLF RFS LTSLP Sbjct: 30 TPPPTADASRVGMSSASASTPSLQSSGMLSREQLLHLFNRFSFLTSLP 77