BLASTX nr result
ID: Alisma22_contig00014123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00014123 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY55157.1 hypothetical protein MANES_03G132300, partial [Maniho... 54 5e-06 >OAY55157.1 hypothetical protein MANES_03G132300, partial [Manihot esculenta] Length = 390 Score = 53.9 bits (128), Expect = 5e-06 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 2/77 (2%) Frame = -3 Query: 347 PKCVLDQDDFWGSTVQEEEHDFTTTMEYTEDEAEHDNNPAERLRKLALPSTSSAAVPNW- 171 P CVLDQD FWGS + T ++ N+PAER++KL + S A VPNW Sbjct: 274 PSCVLDQD-FWGSMEALQSPQGLTLEGFS-------NSPAERMKKL-IECASPAEVPNWT 324 Query: 170 -DSEDWITVRSGSDDDS 123 + +DWITVRS +++ Sbjct: 325 WEEDDWITVRSSDTEET 341