BLASTX nr result
ID: Alisma22_contig00013394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00013394 (849 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ68771.1 hypothetical protein ZOSMA_22G00600 [Zostera marina] 67 8e-11 >KMZ68771.1 hypothetical protein ZOSMA_22G00600 [Zostera marina] Length = 73 Score = 66.6 bits (161), Expect = 8e-11 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +1 Query: 472 DMICIKKVCSKKPCNLSRCSRRCSNAHKRGWGECLKKHPKCCQCNWAC 615 DMIC ++CS C L C C++++K G+GEC KHP CC+C+W C Sbjct: 26 DMICTNRLCSMSLCQLDDCKSYCASSYKSGFGECPLKHPNCCECSWLC 73