BLASTX nr result
ID: Alisma22_contig00013322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00013322 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV56936.1 hypothetical protein CFOL_v3_00475, partial [Cephalot... 69 4e-12 GAV67101.1 hypothetical protein CFOL_v3_10610, partial [Cephalot... 69 5e-12 KYP36120.1 Copia protein [Cajanus cajan] 70 6e-12 GAV91009.1 hypothetical protein CFOL_v3_34409, partial [Cephalot... 69 6e-12 CAH66492.1 H0321H01.1 [Oryza sativa Indica Group] CAH66516.1 OSI... 72 7e-12 GAV76595.1 hypothetical protein CFOL_v3_20068, partial [Cephalot... 69 8e-12 GAV77722.1 hypothetical protein CFOL_v3_21193 [Cephalotus follic... 69 8e-12 GAV80106.1 hypothetical protein CFOL_v3_23568, partial [Cephalot... 68 8e-12 GAV79398.1 hypothetical protein CFOL_v3_22863, partial [Cephalot... 67 9e-12 GAV57805.1 hypothetical protein CFOL_v3_01341, partial [Cephalot... 69 9e-12 GAV78982.1 hypothetical protein CFOL_v3_22447 [Cephalotus follic... 70 9e-12 GAV70620.1 hypothetical protein CFOL_v3_14118 [Cephalotus follic... 69 1e-11 GAV69496.1 hypothetical protein CFOL_v3_12997 [Cephalotus follic... 69 1e-11 KYP71461.1 Retrovirus-related Pol polyprotein from transposon TN... 67 1e-11 XP_019106002.1 PREDICTED: uncharacterized protein LOC109135376 [... 69 1e-11 KYP77867.1 Retrovirus-related Pol polyprotein from transposon TN... 69 1e-11 GAV56658.1 hypothetical protein CFOL_v3_00200 [Cephalotus follic... 67 1e-11 GAV82098.1 hypothetical protein CFOL_v3_25551, partial [Cephalot... 69 1e-11 KYP36591.1 Retrovirus-related Pol polyprotein from transposon TN... 69 1e-11 GAV62033.1 hypothetical protein CFOL_v3_05557 [Cephalotus follic... 69 1e-11 >GAV56936.1 hypothetical protein CFOL_v3_00475, partial [Cephalotus follicularis] Length = 152 Score = 68.9 bits (167), Expect = 4e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 94 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 135 >GAV67101.1 hypothetical protein CFOL_v3_10610, partial [Cephalotus follicularis] Length = 166 Score = 68.9 bits (167), Expect = 5e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 15 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 56 >KYP36120.1 Copia protein [Cajanus cajan] Length = 252 Score = 70.5 bits (171), Expect = 6e-12 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALSTNVLKCV 269 YSD+DYAGC +DRK TSGTC LLG LVSW SKKQ+ VALST+ K + Sbjct: 98 YSDSDYAGCRLDRKSTSGTCHLLGSALVSWHSKKQACVALSTDKAKYI 145 >GAV91009.1 hypothetical protein CFOL_v3_34409, partial [Cephalotus follicularis] Length = 168 Score = 68.9 bits (167), Expect = 6e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 110 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 151 >CAH66492.1 H0321H01.1 [Oryza sativa Indica Group] CAH66516.1 OSIGBa0142C11.4 [Oryza sativa Indica Group] Length = 1566 Score = 71.6 bits (174), Expect = 7e-12 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALSTNVLKCV 269 YSD+DYAGC VDRK T+GTC LGP LVSWFSKKQ+++ LST ++ V Sbjct: 1407 YSDSDYAGCKVDRKSTTGTCQFLGPSLVSWFSKKQNSIVLSTTEVEYV 1454 >GAV76595.1 hypothetical protein CFOL_v3_20068, partial [Cephalotus follicularis] Length = 185 Score = 68.9 bits (167), Expect = 8e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 34 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 75 >GAV77722.1 hypothetical protein CFOL_v3_21193 [Cephalotus follicularis] Length = 170 Score = 68.6 bits (166), Expect = 8e-12 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALSTNVLKCVM 266 +SDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST ++ V+ Sbjct: 88 FSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALSTTEVEYVV 136 >GAV80106.1 hypothetical protein CFOL_v3_23568, partial [Cephalotus follicularis] Length = 155 Score = 68.2 bits (165), Expect = 8e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 6 YSDADYDGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 47 >GAV79398.1 hypothetical protein CFOL_v3_22863, partial [Cephalotus follicularis] Length = 126 Score = 67.4 bits (163), Expect = 9e-12 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSD DY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 68 YSDVDYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 109 >GAV57805.1 hypothetical protein CFOL_v3_01341, partial [Cephalotus follicularis] Length = 194 Score = 68.9 bits (167), Expect = 9e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 43 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 84 >GAV78982.1 hypothetical protein CFOL_v3_22447 [Cephalotus follicularis] Length = 239 Score = 69.7 bits (169), Expect = 9e-12 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALSTNVLKCV 269 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST K V Sbjct: 88 YSDADYGGCKLDRKRTSGTCQFLGNSLVSWFSKKQNSVALSTTEAKYV 135 >GAV70620.1 hypothetical protein CFOL_v3_14118 [Cephalotus follicularis] Length = 200 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 50 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 91 >GAV69496.1 hypothetical protein CFOL_v3_12997 [Cephalotus follicularis] Length = 201 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 50 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 91 >KYP71461.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 104 Score = 66.6 bits (161), Expect = 1e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YS++DYAGC +DRK TSGTC LLG LVSW SKKQ+ VALST Sbjct: 50 YSNSDYAGCRLDRKSTSGTCHLLGSALVSWHSKKQAYVALST 91 >XP_019106002.1 PREDICTED: uncharacterized protein LOC109135376 [Beta vulgaris subsp. vulgaris] Length = 203 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 +SDADYAG LVDRK TSGT LGPCL+SW SKKQ++VALST Sbjct: 133 FSDADYAGFLVDRKSTSGTATFLGPCLISWASKKQNSVALST 174 >KYP77867.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 203 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSD+DYAGC +DRK TSGTC LLG LVSW SKKQ+ VALST Sbjct: 98 YSDSDYAGCRLDRKSTSGTCHLLGSALVSWHSKKQACVALST 139 >GAV56658.1 hypothetical protein CFOL_v3_00200 [Cephalotus follicularis] Length = 137 Score = 67.4 bits (163), Expect = 1e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 +SDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 88 FSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 129 >GAV82098.1 hypothetical protein CFOL_v3_25551, partial [Cephalotus follicularis] Length = 210 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 61 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 102 >KYP36591.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 215 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSD+DYAGC +DRK TSGTC LLG LVSW SKKQ+ VALST Sbjct: 98 YSDSDYAGCRLDRKSTSGTCHLLGSALVSWHSKKQACVALST 139 >GAV62033.1 hypothetical protein CFOL_v3_05557 [Cephalotus follicularis] Length = 216 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 412 YSDADYAGCLVDRKCTSGTCFLLGPCLVSWFSKKQSTVALST 287 YSDADY GC +DRK TSGTC LG LVSWFSKKQ++VALST Sbjct: 65 YSDADYGGCKLDRKSTSGTCQFLGNSLVSWFSKKQNSVALST 106