BLASTX nr result
ID: Alisma22_contig00012758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00012758 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006481777.1 PREDICTED: iron-sulfur assembly protein IscA-like... 109 4e-28 XP_006430202.1 hypothetical protein CICLE_v10012954mg [Citrus cl... 109 4e-28 XP_020109236.1 LOW QUALITY PROTEIN: iron-sulfur assembly protein... 108 1e-27 XP_002282626.1 PREDICTED: iron-sulfur assembly protein IscA-like... 107 3e-27 XP_011624463.1 PREDICTED: iron-sulfur assembly protein IscA-like... 108 3e-27 EOY08243.1 Iron-sulfur cluster biosynthesis family protein isofo... 106 3e-27 XP_019442378.1 PREDICTED: iron-sulfur assembly protein IscA-like... 105 3e-27 XP_009399198.1 PREDICTED: iron-sulfur assembly protein IscA-like... 107 3e-27 XP_009804604.1 PREDICTED: iron-sulfur assembly protein IscA-like... 107 4e-27 XP_009384240.1 PREDICTED: iron-sulfur assembly protein IscA-like... 106 4e-27 XP_009617972.1 PREDICTED: iron-sulfur assembly protein IscA-like... 107 4e-27 XP_009789312.1 PREDICTED: iron-sulfur assembly protein IscA-like... 107 4e-27 XP_018675889.1 PREDICTED: iron-sulfur assembly protein IscA-like... 106 4e-27 JAT64344.1 Iron-sulfur assembly protein IscA-like 2, mitochondri... 107 4e-27 KHG21605.1 hypothetical protein F383_00058 [Gossypium arboreum] 104 4e-27 XP_019241161.1 PREDICTED: iron-sulfur assembly protein IscA-like... 107 4e-27 XP_010244951.1 PREDICTED: iron-sulfur assembly protein IscA-like... 106 5e-27 KMZ57793.1 Iron-sulfur cluster insertion protein ErpA [Zostera m... 107 5e-27 XP_012836112.1 PREDICTED: iron-sulfur assembly protein IscA-like... 106 6e-27 XP_004152897.1 PREDICTED: iron-sulfur assembly protein IscA-like... 106 6e-27 >XP_006481777.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Citrus sinensis] KDO70396.1 hypothetical protein CISIN_1g031188mg [Citrus sinensis] Length = 164 Score = 109 bits (273), Expect = 4e-28 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFEKDGVKLVVDNISYDFVKG+TVDYVEELIRSAF+VS+NPSAVGGCSCKSSFMVK Sbjct: 108 IFEKDGVKLVVDNISYDFVKGATVDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVK 163 >XP_006430202.1 hypothetical protein CICLE_v10012954mg [Citrus clementina] ESR43442.1 hypothetical protein CICLE_v10012954mg [Citrus clementina] Length = 164 Score = 109 bits (273), Expect = 4e-28 Identities = 53/56 (94%), Positives = 56/56 (100%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFEKDGVKLVVDNISYDFVKG+TVDYVEELIRSAF+VS+NPSAVGGCSCKSSFMVK Sbjct: 108 IFEKDGVKLVVDNISYDFVKGATVDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVK 163 >XP_020109236.1 LOW QUALITY PROTEIN: iron-sulfur assembly protein IscA-like 2, mitochondrial [Ananas comosus] Length = 149 Score = 108 bits (269), Expect = 1e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FEKDGVKLVVDNISYDFVKG+TVDYVEELIRSAFLV +NPSAVGGCSCKSSFMVK Sbjct: 94 VFEKDGVKLVVDNISYDFVKGATVDYVEELIRSAFLVVTNPSAVGGCSCKSSFMVK 149 >XP_002282626.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X2 [Vitis vinifera] CBI30295.3 unnamed protein product, partial [Vitis vinifera] Length = 154 Score = 107 bits (267), Expect = 3e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFE+DGVKLVVD ISYDFVKG+TVDYVEELIRSAFLVS+NPSAVGGCSCKSSFMVK Sbjct: 98 IFERDGVKLVVDKISYDFVKGATVDYVEELIRSAFLVSTNPSAVGGCSCKSSFMVK 153 >XP_011624463.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Amborella trichopoda] XP_011624464.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Amborella trichopoda] Length = 180 Score = 108 bits (269), Expect = 3e-27 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAF V++NPSAVGGCSCKSSFMVK Sbjct: 125 VFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFQVTTNPSAVGGCSCKSSFMVK 180 >EOY08243.1 Iron-sulfur cluster biosynthesis family protein isoform 2 [Theobroma cacao] Length = 131 Score = 106 bits (265), Expect = 3e-27 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FE++GVKLVVDNISYDFVKG+TVDYVEELIRSAFLV++NPSAVGGCSCKSSFMVK Sbjct: 75 VFEREGVKLVVDNISYDFVKGATVDYVEELIRSAFLVTTNPSAVGGCSCKSSFMVK 130 >XP_019442378.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial, partial [Lupinus angustifolius] Length = 107 Score = 105 bits (263), Expect = 3e-27 Identities = 49/56 (87%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FEK+G+KLVVDNISYDFVKG+TVDYVEELIRSAF+V+ NPSAVGGCSCKSSFMVK Sbjct: 52 VFEKEGIKLVVDNISYDFVKGATVDYVEELIRSAFVVTENPSAVGGCSCKSSFMVK 107 >XP_009399198.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Musa acuminata subsp. malaccensis] Length = 146 Score = 107 bits (266), Expect = 3e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAF V +NPSAVGGCSCKSSFMVK Sbjct: 91 VFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFQVVTNPSAVGGCSCKSSFMVK 146 >XP_009804604.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana sylvestris] XP_016503625.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] Length = 153 Score = 107 bits (266), Expect = 4e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFE+DGVKLVVDN+SYDFVKG+TVDYVEELIRSAF VS+NPSAVGGCSCKSSFMVK Sbjct: 97 IFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 152 >XP_009384240.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X2 [Musa acuminata subsp. malaccensis] Length = 143 Score = 106 bits (265), Expect = 4e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +F+KDGVKLVVDN+SYDFVKG+TVDYVEELIRSAFLV +NPSAVGGCSCKSSFMVK Sbjct: 88 VFDKDGVKLVVDNVSYDFVKGATVDYVEELIRSAFLVVANPSAVGGCSCKSSFMVK 143 >XP_009617972.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Nicotiana tomentosiformis] XP_016492065.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] XP_018631140.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 157 Score = 107 bits (266), Expect = 4e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFE+DGVKLVVDN+SYDFVKG+TVDYVEELIRSAF VS+NPSAVGGCSCKSSFMVK Sbjct: 101 IFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 156 >XP_009789312.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana sylvestris] XP_016457278.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana tabacum] Length = 158 Score = 107 bits (266), Expect = 4e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFE+DGVKLVVDN+SYDFVKG+TVDYVEELIRSAF VS+NPSAVGGCSCKSSFMVK Sbjct: 102 IFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 157 >XP_018675889.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial isoform X1 [Musa acuminata subsp. malaccensis] Length = 146 Score = 106 bits (265), Expect = 4e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +F+KDGVKLVVDN+SYDFVKG+TVDYVEELIRSAFLV +NPSAVGGCSCKSSFMVK Sbjct: 91 VFDKDGVKLVVDNVSYDFVKGATVDYVEELIRSAFLVVANPSAVGGCSCKSSFMVK 146 >JAT64344.1 Iron-sulfur assembly protein IscA-like 2, mitochondrial [Anthurium amnicola] Length = 159 Score = 107 bits (266), Expect = 4e-27 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FEK+G+KLVVDNISYDFVKG++VDYVEELIRSAFLVS+NPSAVGGCSCKSSFMVK Sbjct: 101 VFEKEGIKLVVDNISYDFVKGASVDYVEELIRSAFLVSTNPSAVGGCSCKSSFMVK 156 >KHG21605.1 hypothetical protein F383_00058 [Gossypium arboreum] Length = 86 Score = 104 bits (260), Expect = 4e-27 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FE+ GVKL+VDNISYDFVKG+TVDY+EELIRSAFLV++NPSAVGGCSCKSSFMVK Sbjct: 30 VFERGGVKLIVDNISYDFVKGATVDYIEELIRSAFLVTTNPSAVGGCSCKSSFMVK 85 >XP_019241161.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] XP_019242787.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nicotiana attenuata] OIT07612.1 iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] OIT19682.1 iron-sulfur assembly protein isca-like 2, mitochondrial [Nicotiana attenuata] Length = 161 Score = 107 bits (266), Expect = 4e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFE+DGVKLVVDN+SYDFVKG+TVDYVEELIRSAF VS+NPSAVGGCSCKSSFMVK Sbjct: 105 IFERDGVKLVVDNVSYDFVKGATVDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 160 >XP_010244951.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Nelumbo nucifera] Length = 149 Score = 106 bits (265), Expect = 5e-27 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FE++GVKLVVDNISYDFVKG+TVDYVEELIRSAFLV++NPSAVGGCSCKSSFMVK Sbjct: 94 VFEREGVKLVVDNISYDFVKGATVDYVEELIRSAFLVTTNPSAVGGCSCKSSFMVK 149 >KMZ57793.1 Iron-sulfur cluster insertion protein ErpA [Zostera marina] Length = 162 Score = 107 bits (266), Expect = 5e-27 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 +FEK+GVKL+VDNISYDFVKG+TVDY EELIRSAFLV+SNPSAVGGCSCKSSFMVK Sbjct: 107 VFEKEGVKLIVDNISYDFVKGATVDYAEELIRSAFLVTSNPSAVGGCSCKSSFMVK 162 >XP_012836112.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Erythranthe guttata] EYU38634.1 hypothetical protein MIMGU_mgv1a015468mg [Erythranthe guttata] Length = 157 Score = 106 bits (265), Expect = 6e-27 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 IFEKDGVKLVVDNIS+DFVKG+T+DYVEELIRSAF VS+NPSAVGGCSCKSSFMVK Sbjct: 102 IFEKDGVKLVVDNISFDFVKGATIDYVEELIRSAFQVSTNPSAVGGCSCKSSFMVK 157 >XP_004152897.1 PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Cucumis sativus] KGN65682.1 hypothetical protein Csa_1G496290 [Cucumis sativus] Length = 157 Score = 106 bits (265), Expect = 6e-27 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -2 Query: 371 IFEKDGVKLVVDNISYDFVKGSTVDYVEELIRSAFLVSSNPSAVGGCSCKSSFMVK 204 I+EK+GVKLVVDNISYDFVKG+T+DYVEELIRSAF+VS+NPSAVGGCSCKSSFMVK Sbjct: 101 IYEKEGVKLVVDNISYDFVKGATIDYVEELIRSAFVVSTNPSAVGGCSCKSSFMVK 156