BLASTX nr result
ID: Alisma22_contig00012747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00012747 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008386761.1 PREDICTED: transcription termination factor MTERF... 53 9e-06 >XP_008386761.1 PREDICTED: transcription termination factor MTERF4, chloroplastic-like [Malus domestica] Length = 377 Score = 52.8 bits (125), Expect = 9e-06 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = +2 Query: 161 DPCAVTTSYLSSACGLSPPKAADVSRKLGRIRSLQRADAVLALLGSYNFSAAQV 322 D A T +YL ++CGLSP AA+ S+KL ++RS RAD+VL LL ++ FSAA + Sbjct: 34 DHDAPTVAYLINSCGLSPESAAEASQKL-KLRSSDRADSVLELLRTHEFSAADI 86