BLASTX nr result
ID: Alisma22_contig00012668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00012668 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ56589.1 Gibberellin-regulated protein 11 [Zostera marina] 92 1e-21 JAT54608.1 Gibberellin-regulated protein 14, partial [Anthurium ... 88 4e-20 XP_009111590.1 PREDICTED: gibberellin-regulated protein 14-like ... 80 7e-17 XP_015168094.1 PREDICTED: gibberellin-regulated protein 3-like [... 78 2e-16 XP_018456849.1 PREDICTED: gibberellin-regulated protein 14-like ... 79 2e-16 XP_004238712.1 PREDICTED: snakin-2-like [Solanum lycopersicum] 78 3e-16 XP_015075702.1 PREDICTED: snakin-2-like [Solanum pennellii] 78 3e-16 XP_017219927.1 PREDICTED: snakin-2-like [Daucus carota subsp. sa... 77 4e-16 XP_009417548.1 PREDICTED: gibberellin-regulated protein 3-like [... 77 4e-16 ERN01700.1 hypothetical protein AMTR_s00090p00169760 [Amborella ... 77 4e-16 XP_010272047.1 PREDICTED: snakin-2-like [Nelumbo nucifera] 77 9e-16 XP_007155392.1 hypothetical protein PHAVU_003G197400g [Phaseolus... 77 1e-15 KYP56265.1 Snakin-2 [Cajanus cajan] 77 1e-15 OIW17715.1 hypothetical protein TanjilG_29065, partial [Lupinus ... 75 1e-15 ONK64268.1 uncharacterized protein A4U43_C07F23870 [Asparagus of... 76 1e-15 KFK33724.1 hypothetical protein AALP_AA5G051700 [Arabis alpina] 77 2e-15 XP_003628630.1 gibberellin-regulated family protein [Medicago tr... 75 3e-15 XP_019241760.1 PREDICTED: gibberellin-regulated protein 3-like [... 75 3e-15 XP_020108551.1 gibberellin-regulated protein 11-like [Ananas com... 75 3e-15 XP_004501957.1 PREDICTED: snakin-2-like [Cicer arietinum] 75 4e-15 >KMZ56589.1 Gibberellin-regulated protein 11 [Zostera marina] Length = 116 Score = 92.0 bits (227), Expect = 1e-21 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -2 Query: 146 ITHVDVKECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 I +VDV ECP LC VRCA HSRPN CHRACG+CC C+CVPPGTYGNR Sbjct: 49 IKYVDVAECPSLCLVRCAKHSRPNHCHRACGTCCFRCKCVPPGTYGNR 96 >JAT54608.1 Gibberellin-regulated protein 14, partial [Anthurium amnicola] Length = 128 Score = 88.2 bits (217), Expect = 4e-20 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = -2 Query: 149 NITHVDVKECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +I VD KECPKLCD RC HSRPN CHRAC +CC CRCVPPGT GNR Sbjct: 60 HIVPVDGKECPKLCDARCWRHSRPNYCHRACQTCCMRCRCVPPGTAGNR 108 >XP_009111590.1 PREDICTED: gibberellin-regulated protein 14-like [Brassica rapa] Length = 134 Score = 80.1 bits (196), Expect = 7e-17 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 128 KECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 K+CPKLCDVRC +H RP +C RAC +CC C+CVPPGTYGNR Sbjct: 73 KDCPKLCDVRCGSHWRPKVCIRACRTCCLRCKCVPPGTYGNR 114 >XP_015168094.1 PREDICTED: gibberellin-regulated protein 3-like [Solanum tuberosum] Length = 90 Score = 77.8 bits (190), Expect = 2e-16 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC VRC+ HSRPNLC RACG+CC C+CVPPGT+GNR Sbjct: 46 DCGGLCKVRCSRHSRPNLCSRACGTCCMRCKCVPPGTFGNR 86 >XP_018456849.1 PREDICTED: gibberellin-regulated protein 14-like [Raphanus sativus] Length = 131 Score = 79.0 bits (193), Expect = 2e-16 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 128 KECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 K+CP LCDVRC +H RP +C RAC +CC C+CVPPGTYGNR Sbjct: 70 KDCPNLCDVRCGSHRRPKVCIRACRTCCLRCKCVPPGTYGNR 111 >XP_004238712.1 PREDICTED: snakin-2-like [Solanum lycopersicum] Length = 105 Score = 77.8 bits (190), Expect = 3e-16 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC VRC+ HSRPNLC RACG+CC C+CVPPGT+GNR Sbjct: 45 DCGGLCKVRCSKHSRPNLCSRACGTCCMRCKCVPPGTFGNR 85 >XP_015075702.1 PREDICTED: snakin-2-like [Solanum pennellii] Length = 106 Score = 77.8 bits (190), Expect = 3e-16 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC VRC+ HSRPNLC RACG+CC C+CVPPGT+GNR Sbjct: 46 DCGGLCKVRCSKHSRPNLCSRACGTCCMRCKCVPPGTFGNR 86 >XP_017219927.1 PREDICTED: snakin-2-like [Daucus carota subsp. sativus] Length = 108 Score = 77.4 bits (189), Expect = 4e-16 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC VRC HSRPN+C RACG+CC C+CVPPGTYGNR Sbjct: 48 DCQGLCKVRCGAHSRPNVCTRACGTCCARCKCVPPGTYGNR 88 >XP_009417548.1 PREDICTED: gibberellin-regulated protein 3-like [Musa acuminata subsp. malaccensis] Length = 109 Score = 77.4 bits (189), Expect = 4e-16 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -2 Query: 137 VDVKECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 V V +C LC VRC+ HSRPNLC RACG+CC C+CVPPGT GNR Sbjct: 45 VPVIDCAGLCGVRCSRHSRPNLCKRACGTCCFRCKCVPPGTSGNR 89 >ERN01700.1 hypothetical protein AMTR_s00090p00169760 [Amborella trichopoda] Length = 110 Score = 77.4 bits (189), Expect = 4e-16 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -2 Query: 137 VDVKECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 VD+KECP LC+ RC HSRPN C R C +CC CRCVPPGT GN+ Sbjct: 46 VDIKECPSLCEGRCLLHSRPNHCKRVCKTCCERCRCVPPGTAGNK 90 >XP_010272047.1 PREDICTED: snakin-2-like [Nelumbo nucifera] Length = 109 Score = 76.6 bits (187), Expect = 9e-16 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC VRC HSRPN+C RACG+CC C+CVPPGTYGNR Sbjct: 49 DCDGLCKVRCGLHSRPNVCTRACGTCCKRCKCVPPGTYGNR 89 >XP_007155392.1 hypothetical protein PHAVU_003G197400g [Phaseolus vulgaris] ESW27386.1 hypothetical protein PHAVU_003G197400g [Phaseolus vulgaris] Length = 114 Score = 76.6 bits (187), Expect = 1e-15 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC RC HSRPNLCHRACG+CC C+CVPPGT GNR Sbjct: 54 DCGGLCKTRCGVHSRPNLCHRACGTCCVRCKCVPPGTSGNR 94 >KYP56265.1 Snakin-2 [Cajanus cajan] Length = 115 Score = 76.6 bits (187), Expect = 1e-15 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C +LC RC+ HSRPN+CHRACG+CC C+CVPPGT GNR Sbjct: 55 DCGELCKSRCSAHSRPNVCHRACGTCCVRCKCVPPGTSGNR 95 >OIW17715.1 hypothetical protein TanjilG_29065, partial [Lupinus angustifolius] Length = 76 Score = 75.5 bits (184), Expect = 1e-15 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -2 Query: 140 HVDVKECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 + D ++C LC RC+ HSRPNLC RACG+CC C+CVPPGT GNR Sbjct: 11 YFDFEDCGGLCKSRCSVHSRPNLCKRACGACCVRCKCVPPGTSGNR 56 >ONK64268.1 uncharacterized protein A4U43_C07F23870 [Asparagus officinalis] Length = 110 Score = 76.3 bits (186), Expect = 1e-15 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGN 6 +C LC VRC+ SRPNLCHRACG+CC C CVPPGTYGN Sbjct: 51 DCKGLCAVRCSKSSRPNLCHRACGTCCFRCNCVPPGTYGN 90 >KFK33724.1 hypothetical protein AALP_AA5G051700 [Arabis alpina] Length = 145 Score = 77.0 bits (188), Expect = 2e-15 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 128 KECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 K+C +LC +RC +H RPN+C RAC +CC C+CVPPGTYGNR Sbjct: 84 KDCARLCGIRCGSHGRPNVCIRACNTCCLRCKCVPPGTYGNR 125 >XP_003628630.1 gibberellin-regulated family protein [Medicago truncatula] AET03106.1 gibberellin-regulated family protein [Medicago truncatula] Length = 112 Score = 75.5 bits (184), Expect = 3e-15 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C C+VRC+ HSRPN+C RACG+CC C+CVPPGTYGNR Sbjct: 52 DCGTRCNVRCSVHSRPNVCMRACGTCCLRCKCVPPGTYGNR 92 >XP_019241760.1 PREDICTED: gibberellin-regulated protein 3-like [Nicotiana attenuata] OIT19189.1 snakin-2 [Nicotiana attenuata] Length = 104 Score = 75.1 bits (183), Expect = 3e-15 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC VRC++HSRPN+C RACG+CC C+CVPPGT GNR Sbjct: 44 DCGGLCKVRCSSHSRPNVCTRACGTCCVRCKCVPPGTSGNR 84 >XP_020108551.1 gibberellin-regulated protein 11-like [Ananas comosus] OAY76155.1 Gibberellin-regulated protein 14 [Ananas comosus] Length = 107 Score = 75.1 bits (183), Expect = 3e-15 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -2 Query: 137 VDVKECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 V + +C LC RC+ HSRPNLC RACG+CC+ C+CVPPGT GNR Sbjct: 43 VPILDCAGLCAGRCSQHSRPNLCARACGTCCSRCKCVPPGTSGNR 87 >XP_004501957.1 PREDICTED: snakin-2-like [Cicer arietinum] Length = 116 Score = 75.1 bits (183), Expect = 4e-15 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 125 ECPKLCDVRCANHSRPNLCHRACGSCCTACRCVPPGTYGNR 3 +C LC +RC++HSRP+LC+RACG+CC C+CVPPGT GNR Sbjct: 56 DCSGLCKLRCSSHSRPSLCYRACGTCCVRCKCVPPGTSGNR 96