BLASTX nr result
ID: Alisma22_contig00012482
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00012482 (692 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008793464.1 PREDICTED: protein GIGANTEA-like [Phoenix dactyli... 61 4e-07 >XP_008793464.1 PREDICTED: protein GIGANTEA-like [Phoenix dactylifera] Length = 1169 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -3 Query: 690 CRLPTTTRCLSHSSVRVRALSTSVLQDIMCSVPMKSYNLCHETTKGTSDP 541 CRL T RCLSH S VRALSTSVL+DIM S P+KS + H ++G DP Sbjct: 1070 CRLSATIRCLSHPSAHVRALSTSVLRDIMYSNPIKSTSFMHGDSQGLRDP 1119