BLASTX nr result
ID: Alisma22_contig00011932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00011932 (582 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO59960.1 VQ motif-containing protein [Corchorus olitorius] 65 8e-10 XP_003633596.1 PREDICTED: VQ motif-containing protein 17 [Vitis ... 65 8e-10 KMT15318.1 hypothetical protein BVRB_3g060240 [Beta vulgaris sub... 65 9e-10 OMO62996.1 VQ motif-containing protein [Corchorus capsularis] 65 1e-09 XP_010672811.1 PREDICTED: VQ motif-containing protein 18 [Beta v... 65 1e-09 CAN68823.1 hypothetical protein VITISV_007107 [Vitis vinifera] 64 2e-09 XP_017976718.1 PREDICTED: VQ motif-containing protein 17 [Theobr... 63 5e-09 XP_010257794.1 PREDICTED: VQ motif-containing protein 25-like [N... 62 6e-09 XP_018860215.1 PREDICTED: VQ motif-containing protein 25-like [J... 62 6e-09 XP_018858818.1 PREDICTED: VQ motif-containing protein 25-like [J... 62 6e-09 KVH94706.1 VQ-like protein [Cynara cardunculus var. scolymus] 62 1e-08 EOY09488.1 VQ motif-containing protein, putative [Theobroma cacao] 63 1e-08 XP_011075264.1 PREDICTED: uncharacterized protein LOC105159777 [... 61 1e-08 XP_003560574.1 PREDICTED: uncharacterized protein LOC100822290 [... 62 1e-08 KJB16310.1 hypothetical protein B456_002G224500 [Gossypium raimo... 61 2e-08 XP_017622668.1 PREDICTED: VQ motif-containing protein 17-like [G... 61 2e-08 XP_016704449.1 PREDICTED: VQ motif-containing protein 17-like [G... 61 2e-08 XP_002323282.2 hypothetical protein POPTR_0016s04530g [Populus t... 61 2e-08 XP_012834319.1 PREDICTED: VQ motif-containing protein 25 [Erythr... 61 2e-08 XP_018848934.1 PREDICTED: VQ motif-containing protein 17 [Juglan... 61 2e-08 >OMO59960.1 VQ motif-containing protein [Corchorus olitorius] Length = 177 Score = 65.1 bits (157), Expect = 8e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 238 AAPKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALE 348 A PKIRIIH+FAPEII+TD ANFR+LVQRLTGK ALE Sbjct: 21 AKPKIRIIHIFAPEIIKTDVANFRELVQRLTGKPALE 57 >XP_003633596.1 PREDICTED: VQ motif-containing protein 17 [Vitis vinifera] CBI32160.3 unnamed protein product, partial [Vitis vinifera] Length = 160 Score = 64.7 bits (156), Expect = 8e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQA 342 PKIRIIH+FAPEIIQTDAANFRDLVQRLTGK A Sbjct: 31 PKIRIIHVFAPEIIQTDAANFRDLVQRLTGKPA 63 >KMT15318.1 hypothetical protein BVRB_3g060240 [Beta vulgaris subsp. vulgaris] Length = 185 Score = 65.1 bits (157), Expect = 9e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALEN 351 PKIRIIH+FAPEII+TD ANFR+LVQRLTGK +LEN Sbjct: 27 PKIRIIHIFAPEIIKTDVANFRELVQRLTGKPSLEN 62 >OMO62996.1 VQ motif-containing protein [Corchorus capsularis] Length = 192 Score = 65.1 bits (157), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 238 AAPKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALE 348 A PKIRIIH+FAPEII+TD ANFR+LVQRLTGK ALE Sbjct: 32 AKPKIRIIHIFAPEIIKTDVANFRELVQRLTGKPALE 68 >XP_010672811.1 PREDICTED: VQ motif-containing protein 18 [Beta vulgaris subsp. vulgaris] Length = 195 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALEN 351 PKIRIIH+FAPEII+TD ANFR+LVQRLTGK +LEN Sbjct: 37 PKIRIIHIFAPEIIKTDVANFRELVQRLTGKPSLEN 72 >CAN68823.1 hypothetical protein VITISV_007107 [Vitis vinifera] Length = 160 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQA 342 PKIRIIH+FAPEIIQTDAANFR+LVQRLTGK A Sbjct: 31 PKIRIIHVFAPEIIQTDAANFRBLVQRLTGKPA 63 >XP_017976718.1 PREDICTED: VQ motif-containing protein 17 [Theobroma cacao] Length = 170 Score = 62.8 bits (151), Expect = 5e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 238 AAPKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALE 348 A PKIRIIH+FAPEII+TD ANFR+LVQRLTGK A E Sbjct: 32 AKPKIRIIHIFAPEIIKTDVANFRELVQRLTGKPAQE 68 >XP_010257794.1 PREDICTED: VQ motif-containing protein 25-like [Nelumbo nucifera] Length = 156 Score = 62.4 bits (150), Expect = 6e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGK 336 PKIRIIH+FAPEIIQTDAANFR+LVQRLTGK Sbjct: 33 PKIRIIHIFAPEIIQTDAANFRELVQRLTGK 63 >XP_018860215.1 PREDICTED: VQ motif-containing protein 25-like [Juglans regia] Length = 163 Score = 62.4 bits (150), Expect = 6e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALE 348 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK + E Sbjct: 34 PKIRIIHIFAPEIIKTDAANFRELVQRLTGKPSTE 68 >XP_018858818.1 PREDICTED: VQ motif-containing protein 25-like [Juglans regia] Length = 163 Score = 62.4 bits (150), Expect = 6e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALE 348 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK + E Sbjct: 34 PKIRIIHIFAPEIIKTDAANFRELVQRLTGKPSTE 68 >KVH94706.1 VQ-like protein [Cynara cardunculus var. scolymus] Length = 168 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQA 342 PKIRIIH+FAPEII+TD ANFRDLVQRLTGK A Sbjct: 33 PKIRIIHIFAPEIIKTDVANFRDLVQRLTGKPA 65 >EOY09488.1 VQ motif-containing protein, putative [Theobroma cacao] Length = 215 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 238 AAPKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALE 348 A PKIRIIH+FAPEII+TD ANFR+LVQRLTGK A E Sbjct: 77 AKPKIRIIHIFAPEIIKTDVANFRELVQRLTGKPAQE 113 >XP_011075264.1 PREDICTED: uncharacterized protein LOC105159777 [Sesamum indicum] Length = 145 Score = 61.2 bits (147), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALEN 351 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK ++ Sbjct: 13 PKIRIIHIFAPEIIKTDAANFRELVQRLTGKPTADD 48 >XP_003560574.1 PREDICTED: uncharacterized protein LOC100822290 [Brachypodium distachyon] KQK17651.1 hypothetical protein BRADI_1g35890 [Brachypodium distachyon] Length = 212 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 229 PPAAAPKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALEN 351 P A P IRIIH+ APEII+TDAANFRDLVQRLTG+ A ++ Sbjct: 36 PKATRPAIRIIHIIAPEIIKTDAANFRDLVQRLTGRDAADD 76 >KJB16310.1 hypothetical protein B456_002G224500 [Gossypium raimondii] Length = 148 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGK 336 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK Sbjct: 36 PKIRIIHIFAPEIIKTDAANFRELVQRLTGK 66 >XP_017622668.1 PREDICTED: VQ motif-containing protein 17-like [Gossypium arboreum] Length = 149 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGK 336 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK Sbjct: 36 PKIRIIHIFAPEIIKTDAANFRELVQRLTGK 66 >XP_016704449.1 PREDICTED: VQ motif-containing protein 17-like [Gossypium hirsutum] Length = 149 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGK 336 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK Sbjct: 36 PKIRIIHIFAPEIIKTDAANFRELVQRLTGK 66 >XP_002323282.2 hypothetical protein POPTR_0016s04530g [Populus trichocarpa] EEF05043.2 hypothetical protein POPTR_0016s04530g [Populus trichocarpa] Length = 149 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGK 336 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK Sbjct: 37 PKIRIIHIFAPEIIKTDAANFRELVQRLTGK 67 >XP_012834319.1 PREDICTED: VQ motif-containing protein 25 [Erythranthe guttata] EYU39932.1 hypothetical protein MIMGU_mgv1a026666mg [Erythranthe guttata] Length = 176 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGKQALEN 351 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK E+ Sbjct: 35 PKIRIIHIFAPEIIKTDAANFRELVQRLTGKPPPED 70 >XP_018848934.1 PREDICTED: VQ motif-containing protein 17 [Juglans regia] Length = 160 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 244 PKIRIIHLFAPEIIQTDAANFRDLVQRLTGK 336 PKIRIIH+FAPEII+TDAANFR+LVQRLTGK Sbjct: 33 PKIRIIHIFAPEIIKTDAANFRELVQRLTGK 63