BLASTX nr result
ID: Alisma22_contig00011907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00011907 (1051 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006412974.1 hypothetical protein EUTSA_v10026705mg [Eutrema s... 54 8e-06 >XP_006412974.1 hypothetical protein EUTSA_v10026705mg [Eutrema salsugineum] ESQ54427.1 hypothetical protein EUTSA_v10026705mg [Eutrema salsugineum] Length = 80 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +2 Query: 491 QSNQHQQHGS-DQGERKFAPRFDGLRFIETLVTAHR 595 + Q +++GS D+G+ KFAPRFDGLRFIETLVTAHR Sbjct: 45 KEKQRKKNGSEDEGDEKFAPRFDGLRFIETLVTAHR 80