BLASTX nr result
ID: Alisma22_contig00010559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00010559 (1150 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY33251.1 hypothetical protein MANES_13G080500 [Manihot esculenta] 55 8e-07 >OAY33251.1 hypothetical protein MANES_13G080500 [Manihot esculenta] Length = 44 Score = 55.5 bits (132), Expect = 8e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -1 Query: 433 SMMTNPKACFSTFAG-PPKSFRLSPGLRASAAFILPWM 323 SMM + KACFS + PP+SFRLSPGLRA AAFILPWM Sbjct: 6 SMMIDLKACFSEHSQWPPESFRLSPGLRACAAFILPWM 43 Score = 53.5 bits (127), Expect = 4e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -2 Query: 108 SMMINPKACFSTFAG-PPKSFRLLPGLRAAAAFILPW 1 SMMI+ KACFS + PP+SFRL PGLRA AAFILPW Sbjct: 6 SMMIDLKACFSEHSQWPPESFRLSPGLRACAAFILPW 42