BLASTX nr result

ID: Alisma22_contig00010431 seq

BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Alisma22_contig00010431
         (725 letters)

Database: ./nr 
           115,041,592 sequences; 42,171,959,267 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADD63027.1 photosystem II protein M (chloroplast) [Potamophila p...    87   1e-18
AAS46110.1 photosystem II M protein (chloroplast) [Oryza sativa ...    86   2e-18
ADD63094.1 photosystem II protein M (chloroplast) [Microlaena st...    80   5e-16
KJB13068.1 hypothetical protein B456_002G055100 [Gossypium raimo...    77   2e-15
XP_002888353.1 hypothetical protein ARALYDRAFT_893970 [Arabidops...    79   5e-15
KJB80637.1 hypothetical protein B456_013G108100 [Gossypium raimo...    75   2e-14
ANF05123.1 photosystem II protein M (chloroplast) [Cynanchum aur...    72   3e-13
YP_009186162.1 photosystem II protein M (chloroplast) [Juglans r...    68   5e-12
YP_009040786.1 photosystem II protein M (chloroplast) (chloropla...    67   1e-11
NP_051053.1 photosystem II protein M [Arabidopsis thaliana] NP_0...    67   2e-11
AKZ30297.1 photosystem II protein M (chloroplast) [Goodenia ovata]     66   3e-11
YP_009108753.1 photosystem II protein M [Oncinotis tenuiloba] YP...    66   3e-11
YP_740644.1 photosystem II protein M [Nandina domestica] YP_0011...    66   3e-11
YP_009145255.1 photosystem II protein M (plastid) [Trillium decu...    66   3e-11
YP_008994562.1 photosystem II protein M (chloroplast) (chloropla...    66   3e-11
YP_009269726.1 photosystem II protein M (plastid) [Cephalanthera...    66   4e-11
AKT94751.1 photosystem II protein M (chloroplast) [Brunonia aust...    66   4e-11
YP_009114443.1 photosystem II protein M (chloroplast) [Paeonia o...    66   4e-11
YP_008578533.1 photosystem II protein M (chloroplast) (chloropla...    66   4e-11
ANZ02095.1 photosystem II protein M (chloroplast) [Dendrobium no...    66   4e-11

>ADD63027.1 photosystem II protein M (chloroplast) [Potamophila parviflora]
          Length = 69

 Score = 86.7 bits (213), Expect = 1e-18
 Identities = 48/64 (75%), Positives = 49/64 (76%)
 Frame = -3

Query: 390 PLNF*ESNLLSLWD*IPSYCEAKKKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTV 211
           PL F      S WD IPSYCE K     E+MEVNILAFIATALFILVPTAFLLIIYVKTV
Sbjct: 11  PLEFTGYPFYSPWDYIPSYCEKK-----EVMEVNILAFIATALFILVPTAFLLIIYVKTV 65

Query: 210 SQND 199
           SQND
Sbjct: 66  SQND 69


>AAS46110.1 photosystem II M protein (chloroplast) [Oryza sativa Japonica
           Group] AAS46173.1 photosystem II M protein (chloroplast)
           [Oryza sativa Japonica Group] ADD62823.1 photosystem II
           protein M (chloroplast) [Oryza sativa Japonica Group]
           ADD62891.1 photosystem II protein M (chloroplast) [Oryza
           meridionalis] ADD62959.1 photosystem II protein M
           (chloroplast) [Oryza australiensis] AGY48933.1
           photosystem II reaction center protein M (chloroplast)
           [Oryza rufipogon]
          Length = 69

 Score = 85.9 bits (211), Expect = 2e-18
 Identities = 48/64 (75%), Positives = 49/64 (76%)
 Frame = -3

Query: 390 PLNF*ESNLLSLWD*IPSYCEAKKKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTV 211
           PL F      S WD IPSYCE K     E+MEVNILAFIATALFILVPTAFLLIIYVKTV
Sbjct: 11  PLEFTGYPFPSPWDYIPSYCEKK-----EVMEVNILAFIATALFILVPTAFLLIIYVKTV 65

Query: 210 SQND 199
           SQND
Sbjct: 66  SQND 69


>ADD63094.1 photosystem II protein M (chloroplast) [Microlaena stipoides]
          Length = 69

 Score = 79.7 bits (195), Expect = 5e-16
 Identities = 46/64 (71%), Positives = 47/64 (73%)
 Frame = -3

Query: 390 PLNF*ESNLLSLWD*IPSYCEAKKKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTV 211
           P  F  S   S WD IPSY E K     E+MEVNILAFIATALFILVPTAFLLIIYVKT 
Sbjct: 11  PPEFTVSPFPSPWDYIPSYYEKK-----EVMEVNILAFIATALFILVPTAFLLIIYVKTA 65

Query: 210 SQND 199
           SQND
Sbjct: 66  SQND 69


>KJB13068.1 hypothetical protein B456_002G055100 [Gossypium raimondii]
          Length = 50

 Score = 77.4 bits (189), Expect = 2e-15
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = -3

Query: 324 KKKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           + KKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 9   RSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 50


>XP_002888353.1 hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp.
           lyrata] EFH64612.1 hypothetical protein
           ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata]
          Length = 120

 Score = 78.6 bits (192), Expect = 5e-15
 Identities = 38/55 (69%), Positives = 46/55 (83%), Gaps = 1/55 (1%)
 Frame = +1

Query: 193 KLIVLTDCFYVNDK*KSGRN*NKECSSNKCENIYFHNLIV-FFFFCFAITRDLIP 354
           KLI+LT+ FYVN K KS RN N+EC SNKC+NIYFHNLIV +++F F I+RDLIP
Sbjct: 66  KLIILTNGFYVNYKQKSSRNENEECGSNKCKNIYFHNLIVYYYYFFFLISRDLIP 120


>KJB80637.1 hypothetical protein B456_013G108100 [Gossypium raimondii]
          Length = 50

 Score = 75.1 bits (183), Expect = 2e-14
 Identities = 37/42 (88%), Positives = 40/42 (95%)
 Frame = -3

Query: 324 KKKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           + KKNNEIMEVNILAFIATALFILVPTAFLLIIYVKT+ Q+D
Sbjct: 9   RSKKNNEIMEVNILAFIATALFILVPTAFLLIIYVKTICQSD 50


>ANF05123.1 photosystem II protein M (chloroplast) [Cynanchum auriculatum]
          Length = 50

 Score = 72.0 bits (175), Expect = 3e-13
 Identities = 36/51 (70%), Positives = 41/51 (80%)
 Frame = -2

Query: 355 MGLDPELLRSXXXXKQ*DYGSKYSRIYCYCTLYSSSYRFFTYHLRKNSQSK 203
           MGL+PELLRS    +  DYGSKYS I CYCT++SSSYR  TYHLRKN+QSK
Sbjct: 1   MGLNPELLRSKKKKRL-DYGSKYSCICCYCTIHSSSYRLSTYHLRKNNQSK 50


>YP_009186162.1 photosystem II protein M (chloroplast) [Juglans regia]
           YP_009306650.1 photosystem II protein M (chloroplast)
           [Juglans sigillata] ALO71557.1 photosystem II protein M
           (chloroplast) [Juglans regia] ANG44774.1 photosystem II
           protein M (chloroplast) [Juglans regia] AOQ30849.1
           photosystem II protein M (chloroplast) [Juglans
           sigillata] APW28890.1 photosystem II protein M
           (chloroplast) [Juglans mandshurica] APW28976.1
           photosystem II protein M (chloroplast) [Juglans
           cathayensis] APW29062.1 photosystem II protein M
           (chloroplast) [Juglans hopeiensis]
          Length = 37

 Score = 68.2 bits (165), Expect = 5e-12
 Identities = 35/37 (94%), Positives = 36/37 (97%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*FD 190
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQND F+
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQNDSFE 37


>YP_009040786.1 photosystem II protein M (chloroplast) (chloroplast) [Centaurea
           diffusa] YP_009235797.1 photosystem II reaction center
           protein (chloroplast) [Saussurea involucrata]
           YP_009341771.1 photosystem II protein M (chloroplast)
           [Castanopsis concinna] AIB03740.1 photosystem II protein
           M (chloroplast) (chloroplast) [Centaurea diffusa]
           AKF00090.1 photosystem II protein M (chloroplast)
           [Orania palindan] AKF00165.1 photosystem II protein M
           (chloroplast) [Pelagodoxa henryana] AKF00239.1
           photosystem II protein M (chloroplast) [Podococcus
           barteri] AKF00299.1 photosystem II protein M
           (chloroplast) [Prestoea acuminata var. montana]
           AKF00356.1 photosystem II protein M (chloroplast)
           [Reinhardtia gracilis] AKF00431.1 photosystem II protein
           M (chloroplast) [Reinhardtia latisecta] AKF00495.1
           photosystem II protein M (chloroplast) [Roystonea regia]
           AKF00635.1 photosystem II protein M (chloroplast)
           [Reinhardtia simplex] AKF00696.1 photosystem II protein
           M (chloroplast) [Satakentia liukiuensis] AKF00768.1
           photosystem II protein M (chloroplast) [Sclerosperma
           profizianum] AKF00992.1 photosystem II protein M
           (chloroplast) [Attalea speciosa] AKF01068.1 photosystem
           II protein M (chloroplast) [Bactris major] AKF01144.1
           photosystem II protein M (chloroplast) [Beccariophoenix
           madagascariensis] AKF01226.1 photosystem II protein M
           (chloroplast) [Burretiokentia grandiflora] AKF01290.1
           photosystem II protein M (chloroplast) [Dictyosperma
           album] AKF01368.1 photosystem II protein M (chloroplast)
           [Drymophloeus litigiosus] AKF01440.1 photosystem II
           protein M (chloroplast) [Dypsis decaryi] AKF01525.1
           photosystem II protein M (chloroplast) [Geonoma undata
           subsp. dussiana] AKF01600.1 photosystem II protein M
           (chloroplast) [Heterospathe cagayanensis] AKF01681.1
           photosystem II protein M (chloroplast) [Hydriastele
           microspadix] AKF01846.1 photosystem II protein M
           (chloroplast) [Kentiopsis piersoniorum] AKF01910.1
           photosystem II protein M (chloroplast) [Leopoldinia
           pulchra] AKF02070.1 photosystem II protein M
           (chloroplast) [Oenocarpus bataua] AKF02131.1 photosystem
           II protein M (chloroplast) [Oenocarpus minor] ALN96566.1
           photosystem II protein M (chloroplast) [Castanopsis
           concinna] AMD61937.1 photosystem II reaction center
           protein (chloroplast) [Saussurea involucrata]
          Length = 35

 Score = 67.0 bits (162), Expect = 1e-11
 Identities = 34/35 (97%), Positives = 35/35 (100%)
 Frame = -3

Query: 303 IMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           +MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 35


>NP_051053.1 photosystem II protein M [Arabidopsis thaliana] NP_054490.1
           photosystem II protein M [Nicotiana tabacum] NP_039371.1
           photosystem II protein M [Oryza sativa Japonica Group]
           NP_054926.1 photosystem II protein M (plastid) [Spinacia
           oleracea] NP_783226.1 photosystem II protein M [Atropa
           belladonna] YP_052737.1 photosystem II protein M
           (chloroplast) [Oryza nivara] YP_053149.1 photosystem II
           protein M [Nymphaea alba] YP_319759.1 photosystem II
           protein M [Acorus calamus] YP_358667.1 photosystem II
           protein M [Nicotiana sylvestris] YP_358572.1 photosystem
           II protein M [Phalaenopsis aphrodite subsp. formosana]
           YP_398854.1 photosystem II protein M [Nicotiana
           tomentosiformis] YP_538842.1 photosystem II protein M
           [Solanum bulbocastanum] YP_588103.1 photosystem II
           protein M (chloroplast) [Helianthus annuus] YP_635633.1
           photosystem II protein M [Solanum tuberosum] YP_740196.1
           photosystem II protein M [Liriodendron tulipifera]
           YP_740559.1 photosystem II protein M [Platanus
           occidentalis] YP_778484.1 photosystem II protein M
           [Jasminum nudiflorum] YP_784380.1 photosystem II protein
           M [Drimys granadensis] YP_001001528.1 photosystem II
           protein M [Nuphar advena] YP_001004180.1 photosystem II
           protein M [Ranunculus macranthus] YP_001123367.1
           photosystem II protein M [Capsella bursa-pastoris]
           YP_001123280.1 PSII low MW protein [Barbarea verna]
           YP_001123631.1 photosystem II protein M [Lepidium
           virginicum] YP_001123808.1 photosystem II protein M
           [Nasturtium officinale] YP_001123109.1 photosystem II
           protein M [Olimarabidopsis pumila] YP_001123456.1
           photosystem II protein M [Crucihimalaya wallichii]
           YP_001294092.1 photosystem II protein M [Chloranthus
           spicatus] YP_001294346.1 photosystem II protein M
           [Dioscorea elephantipes] YP_001294264.1 photosystem II
           protein M [Illicium oligandrum] YP_001294178.1
           photosystem II protein M [Buxus microphylla]
           YP_001468302.1 photosystem II protein M [Ipomoea
           purpurea] YP_001586176.1 photosystem II protein M
           [Acorus americanus] YP_001595502.1 PSII M protein [Lemna
           minor] YP_001837346.1 photosystem II protein M [Guizotia
           abyssinica] YP_001936511.1 photosystem II protein M
           [Fagopyrum esculentum subsp. ancestrale] YP_002836084.1
           photosystem II protein M [Megaleranthis saniculifolia]
           YP_003029728.1 PsbM (chloroplast) [Bambusa oldhamii]
           YP_003097564.1 photosystem II protein M (chloroplast)
           [Dendrocalamus latiflorus] YP_003359353.1 photosystem II
           protein M (chloroplast) [Olea europaea] YP_003433969.1
           photosystem II protein M [Typha latifolia]
           YP_003540925.1 photosystem II protein M [Phoenix
           dactylifera] YP_003587656.1 photosystem II protein M
           [Anomochloa marantoidea] YP_004021144.1 photosystem II
           protein M [Castanea mollissima] YP_004376415.1
           photosystem II protein M [Olea europaea subsp. europaea]
           YP_004563861.1 photosystem II protein M [Nelumbo lutea]
           YP_004563775.1 photosystem II protein M [Olea europaea
           subsp. cuspidata] YP_004563998.1 photosystem II protein
           M [Olea woodiana subsp. woodiana] YP_004564358.1
           photosystem II protein M (chloroplast) [Ageratina
           adenophora] YP_004564491.1 photosystem II protein M
           [Olea europaea subsp. maroccana] YP_004733233.1
           photosystem II protein M (plastid) [Indocalamus
           longiauritus] YP_004733567.1 photosystem II protein M
           (chloroplast) [Phyllostachys edulis] YP_004733749.1
           photosystem II protein M (chloroplast) [Acidosasa
           purpurea] YP_004733967.1 photosystem II protein M
           (chloroplast) [Phyllostachys nigra var. henonis]
           YP_004734090.1 photosystem II protein M (chloroplast)
           [Bambusa emeiensis] YP_004734174.1 photosystem II
           protein M (plastid) [Ferrocalamus rimosivaginus]
           YP_004769624.1 photosystem II protein M (chloroplast)
           [Spirodela polyrhiza] YP_004769708.1 photosystem II
           protein M [Magnolia kwangsiensis] YP_004769806.1
           photosystem II protein M (chloroplast) [Wolffiella
           lingulata] YP_004769941.1 photosystem II protein M
           (chloroplast) [Wolffia australiana] YP_004891595.1 psbM
           gene product (chloroplast) [Nicotiana undulata]
           YP_004935660.1 PSII M protein (chloroplast) [Sesamum
           indicum] YP_004940504.1 psbM gene product (chloroplast)
           [Dorcoceras hygrometricum] YP_005087998.1 psbM gene
           product [Leersia tisserantii] YP_005088521.1 psbM gene
           product (chloroplast) [Phyllostachys propinqua]
           YP_005089135.1 psbM gene product [Rhynchoryza subulata]
           YP_005089328.1 psbM gene product (chloroplast) [Silene
           vulgaris] YP_005089409.1 psbM gene product (chloroplast)
           [Silene noctiflora] YP_005089490.1 psbM gene product
           (chloroplast) [Silene conica] YP_005089571.1 psbM gene
           product (chloroplast) [Silene latifolia] YP_005097868.1
           photosystem II protein M (chloroplast) [Colocasia
           esculenta] YP_005296407.1 psbM gene product
           (chloroplast) [Oryza meridionalis] YP_006073098.1
           photosystem II protein M (chloroplast) [Elaeis
           guineensis] YP_006073262.1 photosystem II protein M
           (chloroplast) [Phalaenopsis equestris] YP_006280748.1
           psbM gene product (chloroplast) [Oryza rufipogon]
           YP_006503785.1 photosystem II M protein (chloroplast)
           [Datura stramonium] YP_006576109.1 PsbM (chloroplast)
           [Magnolia denudata] YP_006665774.1 photosystem II
           protein M (chloroplast) [Elodea canadensis]
           YP_006666024.1 photosystem II protein M (chloroplast)
           [Capsicum annuum] YP_007317242.1 PSII M protein
           (chloroplast) [Camellia sinensis] YP_007353909.1
           photosystem II protein M (chloroplast) [Tectona grandis]
           YP_007375037.1 photosystem II protein M [Quercus rubra]
           YP_007474364.1 photosystem II M protein (chloroplast)
           [Magnolia officinalis] YP_007474446.1 photosystem II M
           protein (chloroplast) [Magnolia officinalis subsp.
           biloba] YP_007474530.1 photosystem II M protein
           (chloroplast) [Magnolia grandiflora] YP_007475128.1
           photosystem II protein M (chloroplast) [Arundinaria
           gigantea] YP_007475613.1 photosystem II protein M
           [Heliconia collinsiana] YP_007475698.1 photosystem II
           protein M [Zingiber spectabile] YP_007475783.1
           photosystem II protein M [Pseudophoenix vinifera]
           YP_007475955.1 photosystem II protein M [Bismarckia
           nobilis] YP_007476041.1 photosystem II protein M
           [Dasypogon bromeliifolius] YP_007475869.1 photosystem II
           protein M [Calamus caryotoides] YP_007476345.1 PsbM
           (chloroplast) [Trithuria inconspicua] YP_007507105.1
           photosystem II M protein (chloroplast) [Salvia
           miltiorrhiza] YP_007889936.1 photosystem II protein M
           (chloroplast) [Pachycladon cheesemanii] YP_008081259.1
           photosystem II protein M (chloroplast) (chloroplast)
           [Catharanthus roseus] YP_008081359.1 photosystem II
           protein M (chloroplast) [Tetracentron sinense]
           YP_008081451.1 photosystem II protein M (chloroplast)
           [Trochodendron aralioides] YP_008082575.1 photosystem II
           protein M (chloroplast) [Utricularia gibba]
           YP_008378780.1 photosystem II protein M (chloroplast)
           [Najas flexilis] YP_008520133.1 photosystem II protein M
           (chloroplast) [Camellia taliensis] YP_008563082.1
           photosystem II protein M (chloroplast) [Solanum
           lycopersicum] YP_008578279.1 photosystem II protein M
           (chloroplast) [Cocos nucifera] YP_008592751.1
           photosystem II protein M (chloroplast) [Camellia
           cuspidata] YP_008592840.1 photosystem II protein M
           (chloroplast) [Camellia danzaiensis] YP_008592927.1
           photosystem II protein M (chloroplast) [Camellia
           impressinervis] YP_008593105.1 photosystem II protein M
           (chloroplast) [Camellia yunnanensis] YP_008592482.1 PSII
           M protein (chloroplast) [Andrographis paniculata]
           YP_008593016.1 photosystem II protein M (chloroplast)
           [Camellia pitardii] YP_008815931.1 photosystem II
           protein M (chloroplast) [Lindenbergia philippensis]
           YP_008854419.1 photosystem II protein M [Musa textilis]
           YP_008854505.1 photosystem II protein M [Ravenala
           madagascariensis] YP_008854588.1 photosystem II protein
           M [Curcuma roscoeana] YP_008963300.1 photosystem II
           protein M [Camellia oleifera] YP_008963474.1 photosystem
           II protein M (chloroplast) [Penthorum chinense]
           YP_008964343.1 photosystem II protein M [Helianthus
           divaricatus] YP_008964428.1 photosystem II protein M
           [Helianthus decapetalus] YP_008964683.1 photosystem II
           protein M [Helianthus strumosus] YP_008964768.1
           photosystem II protein M [Helianthus maximiliani]
           YP_008964028.1 photosystem II protein M [Ajuga reptans]
           YP_008964173.1 photosystem II protein M [Helianthus
           giganteus] YP_008964258.1 photosystem II protein M
           [Helianthus grosseserratus] YP_008964513.1 photosystem
           II protein M [Helianthus hirsutus] YP_008964598.1
           photosystem II protein M [Helianthus tuberosus]
           YP_008993963.1 photosystem II protein M (chloroplast)
           [Pharus lappulaceus] YP_008993170.1 photosystem II
           protein M (chloroplast) [Magnolia cathcartii]
           YP_008993256.1 photosystem II protein M (chloroplast)
           [Magnolia dealbata] YP_008993342.1 photosystem II
           protein M (chloroplast) [Magnolia pyramidata]
           YP_008993428.1 photosystem II protein M (chloroplast)
           [Magnolia kobus] YP_008993514.1 photosystem II protein M
           (chloroplast) [Magnolia liliifera] YP_008993600.1
           photosystem II protein M (chloroplast) [Magnolia odora]
           YP_008993772.1 photosystem II protein M (chloroplast)
           [Magnolia sinica] YP_008993858.1 photosystem II protein
           M (chloroplast) [Magnolia sprengeri] YP_008993686.1
           photosystem II protein M (chloroplast) [Magnolia
           salicifolia] YP_008964861.1 photosystem II protein M
           (chloroplast) [Schwalbea americana] YP_009000009.1
           photosystem II protein M (chloroplast) [Silene conoidea]
           YP_009000170.1 photosystem II protein M (chloroplast)
           [Silene paradoxa] YP_009000090.1 photosystem II protein
           M (chloroplast) [Silene chalcedonica] YP_009001981.1
           photosystem II protein M (chloroplast) [Puelia
           olyriformis] YP_009002252.1 photosystem II protein M
           (chloroplast) [Pinguicula ehlersiae] YP_009020214.1
           photosystem II protein M (chloroplast) [Castanopsis
           echinocarpa] YP_009020729.1 photosystem II protein M
           (chloroplast) [Praxelis clematidea] YP_009024243.1
           photosystem II protein M (chloroplast) [Arundinaria
           appalachiana] YP_009024326.1 photosystem II protein M
           (chloroplast) [Arundinaria tecta] YP_009024787.1
           photosystem II protein M (chloroplast) [Trigonobalanus
           doichangensis] YP_009026875.1 photosystem II protein M
           (plastid) [Magnolia tripetala] YP_009033432.1
           photosystem II protein M (plastid) [Olyra latifolia]
           YP_009034085.1 photosystem II protein M (plastid) [Oryza
           glaberrima] YP_009033879.1 photosystem II protein M
           (plastid) [Dioscorea rotundata] YP_009040312.1
           photosystem II protein M [Hyoscyamus niger]
           YP_009041081.1 photosystem II protein M [Rhazya stricta]
           YP_009047926.1 photosystem II protein M (chloroplast)
           [Camellia crapnelliana] YP_009048015.1 photosystem II
           protein M (chloroplast) [Nymphaea mexicana]
           YP_009048281.1 photosystem II protein M (chloroplast)
           [Magnolia yunnanensis] YP_009049257.1 photosystem II
           protein M (chloroplast) [Oryza australiensis]
           YP_009050582.1 photosystem II protein M (chloroplast)
           [Camellia grandibracteata] YP_009050669.1 photosystem II
           protein M (chloroplast) [Camellia leptophylla]
           YP_009050756.1 photosystem II protein M (chloroplast)
           [Camellia petelotii] YP_009050843.1 photosystem II
           protein M (chloroplast) [Camellia pubicosta]
           YP_009050930.1 photosystem II protein M (chloroplast)
           [Camellia reticulata] YP_009051239.1 photosystem II
           protein M (chloroplast) [Bambusa multiplex]
           YP_009051324.1 photosystem II protein M (chloroplast)
           [Phyllostachys sulphurea] YP_009052573.1 photosystem II
           protein M (chloroplast) [Arundinaria fargesii]
           YP_009052656.1 photosystem II protein M (chloroplast)
           [Sarocalamus faberi] YP_009052740.1 photosystem II
           protein M (chloroplast) [Chimonocalamus longiusculus]
           YP_009052822.1 photosystem II protein M (chloroplast)
           [Fargesia nitida] YP_009052905.1 photosystem II protein
           M (chloroplast) [Fargesia spathacea] YP_009052988.1
           photosystem II protein M (chloroplast) [Fargesia
           yunnanensis] YP_009053071.1 photosystem II protein M
           (chloroplast) [Gaoligongshania megalothyrsa]
           YP_009053154.1 photosystem II protein M (chloroplast)
           [Gelidocalamus tessellatus] YP_009053237.1 photosystem
           II protein M (chloroplast) [Indocalamus wilsonii]
           YP_009053320.1 photosystem II protein M (chloroplast)
           [Indosasa sinica] YP_009053402.1 photosystem II protein
           M (chloroplast) [Oligostachyum shiuyingianum]
           YP_009053649.1 photosystem II protein M (chloroplast)
           [Yushania levigata] YP_009053484.1 photosystem II
           protein M (chloroplast) [Pleioblastus maculatus]
           YP_009053566.1 photosystem II protein M (chloroplast)
           [Thamnocalamus spathiflorus] YP_009053868.1 photosystem
           II protein M (plastid) [Ampelocalamus calcareus]
           YP_009093944.1 photosystem II protein M (chloroplast)
           [Nelumbo nucifera] YP_009092761.1 photosystem II protein
           M [Bomarea edulis] YP_009093794.1 photosystem II protein
           M (chloroplast) [Luzuriaga radicans] YP_009108435.1
           photosystem II protein M (chloroplast) [Genlisea
           margaretae] YP_009107557.1 photosystem II protein M
           (chloroplast) [Phalaenopsis hybrid cultivar]
           YP_009108492.1 photosystem II protein M (chloroplast)
           [Utricularia macrorhiza] YP_009110596.1 photosystem II
           protein M (chloroplast) [Hesperelaea palmeri]
           YP_009108668.1 photosystem II protein M [Nerium
           oleander] YP_009114863.1 photosystem II protein M
           [Thalictrum coreanum] YP_009116336.1 photosystem II
           protein M (chloroplast) [Ananas comosus] YP_009117215.1
           photosystem II protein M (chloroplast) [Premna
           microphylla] YP_009117669.1 photosystem II protein M
           (plastid) [Acorus gramineus] YP_009128065.1 photosystem
           II protein M (chloroplast) [Actinidia deliciosa]
           YP_009128175.1 photosystem II protein M (chloroplast)
           [Saracha punctata] YP_009128385.1 photosystem II protein
           M (chloroplast) [Ipomoea batatas] YP_009128834.1
           photosystem II protein M (chloroplast) [Iochroma
           loxense] YP_009123246.1 photosystem II protein M
           (chloroplast) [Chloranthus japonicus] YP_009123627.1
           photosystem II protein M (chloroplast) [Iochroma
           stenanthum] YP_009123736.1 photosystem II protein M
           [Lithocarpus balansae] YP_009127982.1 photosystem II
           protein M (chloroplast) [Actinidia chinensis]
           YP_009123151.1 photosystem II protein M (chloroplast)
           [Dunalia obovata] YP_009123345.1 photosystem II protein
           M (chloroplast) [Iochroma nitidum] YP_009129354.1
           photosystem II protein M (chloroplast) [Cypripedium
           formosanum] YP_009130121.1 photosystem II protein M
           (chloroplast) [Carludovica palmata] YP_009130316.1
           photosystem II protein M (chloroplast) [Quercus aliena]
           YP_009131707.1 photosystem II protein M (chloroplast)
           [Solanum cheesmaniae] YP_009131956.1 photosystem II
           protein M (chloroplast) [Solanum habrochaites]
           YP_009132039.1 photosystem II protein M (chloroplast)
           [Solanum neorickii] YP_009132830.1 photosystem II
           protein M (chloroplast) [Quercus spinosa] YP_009133049.1
           photosystem II protein M (chloroplast) [Quercus
           aquifolioides] YP_009131790.1 photosystem II protein M
           (chloroplast) [Solanum chilense] YP_009131873.1
           photosystem II protein M (chloroplast) [Solanum
           galapagense] YP_009132122.1 photosystem II protein M
           (chloroplast) [Solanum peruvianum] YP_009132205.1
           photosystem II protein M (chloroplast) [Solanum
           pimpinellifolium] YP_009132746.1 photosystem II protein
           M (chloroplast) [Dunalia brachyacantha] YP_009120911.1
           photosystem II protein M (plastid) [Sabal domingensis]
           YP_009120997.1 photosystem II protein M (plastid)
           [Cardamine impatiens] YP_009121082.1 photosystem II
           protein M (plastid) [Cardamine resedifolia]
           YP_009122858.1 photosystem II protein M (chloroplast)
           [Capsicum lycianthoides] YP_009123519.1 photosystem II
           protein M (plastid) [Physalis peruviana] YP_009134769.1
           photosystem II protein M (plastid) [Bambusa bambos]
           YP_009134852.1 photosystem II protein M (plastid)
           [Bambusa arnhemica] YP_009134935.1 photosystem II
           protein M (plastid) [Chusquea spectabilis]
           YP_009135018.1 photosystem II protein M (plastid)
           [Diandrolyra sp. Clark 1301] YP_009135098.1 photosystem
           II protein M (plastid) [Greslania sp. McPherson 19217]
           YP_009135181.1 photosystem II protein M (plastid)
           [Hickelia madagascariensis] YP_009135264.1 photosystem
           II protein M (plastid) [Neohouzeaua sp. Clark & Attigala
           1712] YP_009135347.1 photosystem II protein M (plastid)
           [Neololeba atra] YP_009135430.1 photosystem II protein M
           (plastid) [Olmeca reflexa] YP_009135513.1 photosystem II
           protein M (plastid) [Raddia brasiliensis] YP_009135681.1
           photosystem II protein M (plastid) [Buergersiochloa
           bambusoides] YP_009135764.1 photosystem II protein M
           (plastid) [Chusquea liebmannii] YP_009135846.1
           photosystem II protein M (plastid) [Lithachne
           pauciflora] YP_009135926.1 photosystem II protein M
           (plastid) [Otatea acuminata] YP_009136009.1 photosystem
           II protein M (plastid) [Pariana radiciflora]
           YP_009136726.1 photosystem II protein M (plastid)
           [Guadua weberbaueri] YP_009139095.1 photosystem II
           protein M (chloroplast) [Dioscorea zingiberensis]
           YP_009139462.1 photosystem II protein M (chloroplast)
           [Dunalia solanacea] YP_009139774.1 photosystem II
           protein M (chloroplast) [Cynara humilis] YP_009141857.1
           photosystem II protein M (chloroplast) [Xerophyllum
           tenax] YP_009141944.1 photosystem II protein M
           (chloroplast) [Heloniopsis tubiflora] YP_009142044.1
           PsbM (chloroplast) [Fagopyrum tataricum] YP_009142320.1
           photosystem II protein M (chloroplast) [Iochroma
           tingoanum] YP_009142477.1 photosystem II protein M
           (chloroplast) [Chikusichloa aquatica] YP_009145098.1
           photosystem II protein M (chloroplast) [Podococcus
           barteri] YP_009143883.1 photosystem II protein M
           (plastid) [Cypripedium japonicum] YP_009144316.1
           photosystem II protein M (plastid) [Carex siderosticta]
           YP_009144509.1 PSII M protein (chloroplast) [Rosmarinus
           officinalis] YP_009144973.1 photosystem II protein M
           (chloroplast) [Dieffenbachia seguine] YP_009155529.1
           photosystem II protein M (chloroplast) [Oryza barthii]
           YP_009155611.1 photosystem II protein M (chloroplast)
           [Oryza glumipatula] YP_009155694.1 photosystem II
           protein M (chloroplast) [Oryza longistaminata]
           YP_009155777.1 photosystem II protein M (chloroplast)
           [Oryza officinalis] YP_009156194.1 photosystem II
           protein M (plastid) [Avena sativa] YP_009156362.1
           photosystem II protein M (plastid) [Brachyelytrum
           aristosum] YP_009156697.1 photosystem II protein M
           (plastid) [Diarrhena obovata] YP_009156946.1 photosystem
           II protein M (plastid) [Melica mutica] YP_009157029.1
           photosystem II protein M (plastid) [Melica subulata]
           YP_009157196.1 photosystem II protein M (plastid)
           [Phaenosperma globosum] YP_009157280.1 photosystem II
           protein M (plastid) [Phalaris arundinacea]
           YP_009157891.1 photosystem II protein M (plastid)
           [Chusquea circinata] YP_009157975.1 photosystem II
           protein M (plastid) [Pariana campestris] YP_009154772.1
           photosystem II protein M (chloroplast) [Aster
           spathulifolius] YP_009159820.1 photosystem II protein M
           (chloroplast) [Carnegiea gigantea] YP_009162255.1
           photosystem II M protein (chloroplast) [Scutellaria
           baicalensis] YP_009161178.1 PsbM (chloroplast) [Oryza
           punctata] YP_009161352.1 PsbM (chloroplast) [Oryza
           sativa Indica Group] YP_009161548.1 photosystem II
           protein M (chloroplast) [Pinellia ternata]
           YP_009161915.1 photosystem II protein M (chloroplast)
           [Capsella rubella] YP_009162871.1 photosystem II protein
           M (chloroplast) [Rheum palmatum] YP_009164575.1
           photosystem II protein M (chloroplast) [Lathraea
           squamaria] YP_009166599.1 photosystem II protein M
           (chloroplast) [Epipremnum aureum] YP_009166685.1
           photosystem II protein M (chloroplast) [Tanaecium
           tetragonolobum] YP_009169350.1 photosystem II protein M
           (chloroplast) [Clematis terniflora] YP_009169480.1
           photosystem II protein M (chloroplast) [Cynara baetica]
           YP_009169567.1 photosystem II protein M (chloroplast)
           [Cynara cornigera] YP_009169662.1 PsbM (chloroplast)
           [Capsicum frutescens] YP_009170171.1 photosystem II
           protein M (plastid) [Colpothrinax cookii] YP_009171776.1
           PsbM (chloroplast) [Solanum commersonii] YP_009171862.1
           PsbM (chloroplast) [Solanum nigrum] YP_009172271.1
           photosystem II protein M (chloroplast) [Colobanthus
           quitensis] YP_009175267.1 photosystem II protein M
           (chloroplast) [Phragmipedium longifolium] YP_009178652.1
           photosystem II protein M (chloroplast) [Pseudosasa
           japonica] YP_009179050.1 photosystem II protein M
           (chloroplast) [Ostrya rehderiana] YP_009179946.1
           photosystem II protein M (chloroplast) [Bletilla
           striata] YP_009180365.1 photosystem II protein M
           (chloroplast) [Musa balbisiana] YP_009182885.1
           photosystem II protein M (chloroplast) [Capsella
           grandiflora] YP_009182983.1 photosystem II protein M
           (plastid) [Plantago maritima] YP_009183073.1 photosystem
           II protein M (plastid) [Plantago media] YP_009183586.1
           photosystem II protein M (chloroplast) [Scutellaria
           insignis] YP_009184048.1 photosystem II protein M
           (chloroplast) [Dendrobium chrysotoxum] YP_009186480.1
           photosystem II protein M (plastid) [Otatea glauca]
           YP_009192956.1 photosystem II protein M (chloroplast)
           [Curcuma flaviflora] YP_009228758.1 photosystem II
           protein M (chloroplast) [Metanarthecium luteoviride]
           YP_009229201.1 photosystem II protein M (chloroplast)
           [Guadua chacoensis] YP_009229375.1 photosystem II
           protein M (chloroplast) [Syagrus coronata]
           YP_009231069.1 photosystem II protein M (chloroplast)
           [Camelina sativa] YP_009234380.1 photosystem II protein
           M (chloroplast) [Akebia trifoliata] YP_009234549.1
           photosystem II protein M (chloroplast) [Euptelea
           pleiosperma] YP_009234634.1 photosystem II protein M
           (chloroplast) [Meliosma aff. cuneifolia Moore 333]
           YP_009234803.1 photosystem II protein M (chloroplast)
           [Stephania japonica] YP_009234888.1 photosystem II
           protein M (chloroplast) [Pachysandra terminalis]
           YP_009236490.1 photosystem II protein M (chloroplast)
           [Quercus baronii] YP_009239071.1 photosystem II protein
           M (chloroplast) [Monsonia emarginata] YP_009240593.1
           photosystem II protein M (chloroplast) [Iochroma
           cardenasianum] YP_009240697.1 photosystem II protein M
           (chloroplast) [Guadua angustifolia] YP_009240788.1 PSII
           M protein (chloroplast) [Diplopanax stachyanthus]
           YP_009241301.1 psbM (chloroplast) [Drosera rotundifolia]
           YP_009241740.1 photosystem II protein M (plastid)
           [Tofieldia thibetica] YP_009241825.1 photosystem II
           protein M (plastid) [Potamogeton perfoliatus]
           YP_009241910.1 photosystem II protein M (plastid)
           [Sagittaria lichuanensis] YP_009242057.1 photosystem II
           protein M (chloroplast) [Stenogyne haliakalae]
           YP_009242145.1 photosystem II protein M (chloroplast)
           [Stenogyne bifida] YP_009242233.1 photosystem II protein
           M (chloroplast) [Haplostachys haplostachya]
           YP_009242321.1 photosystem II protein M (chloroplast)
           [Phyllostegia velutina] YP_009242409.1 photosystem II
           protein M (chloroplast) [Stenogyne kanehoana]
           YP_009242497.1 photosystem II protein M (chloroplast)
           [Stachys chamissonis] YP_009242585.1 photosystem II
           protein M (chloroplast) [Stachys coccinea]
           YP_009242673.1 photosystem II protein M (chloroplast)
           [Stachys sylvatica] YP_009242761.1 photosystem II
           protein M (chloroplast) [Stachys byzantina]
           YP_009243024.1 photosystem II M protein (chloroplast)
           [Aconitum chiisanense] YP_009243210.1 photosystem II
           protein M (chloroplast) [Iochroma australe]
           YP_009245004.1 photosystem II M protein (chloroplast)
           [Kolkwitzia amabilis] YP_009247060.1 photosystem II
           protein M (chloroplast) [Mauritia flexuosa]
           YP_009247146.1 photosystem II protein M (plastid)
           [Caryota mitis] YP_009247232.1 photosystem II protein M
           (plastid) [Wallichia densiflora] YP_009247317.1
           photosystem II protein M (plastid) [Veitchia arecina]
           YP_009247403.1 photosystem II protein M (plastid)
           [Trithrinax brasiliensis] YP_009247489.1 photosystem II
           protein M (plastid) [Tahina spectabilis] YP_009247569.1
           photosystem II protein M (plastid) [Serenoa repens]
           YP_009247741.1 photosystem II protein M (plastid)
           [Pritchardia thurstonii] YP_009247827.1 photosystem II
           protein M (plastid) [Pigafetta elata] YP_009247914.1
           photosystem II protein M (plastid) [Phytelephas
           aequatorialis] YP_009248000.1 photosystem II protein M
           (plastid) [Nypa fruticans] YP_009248086.1 photosystem II
           protein M (plastid) [Metroxylon warburgii]
           YP_009248172.1 photosystem II protein M (plastid)
           [Lodoicea maldivica] YP_009248258.1 photosystem II
           protein M (plastid) [Leucothrinax morrisii]
           YP_009248344.1 photosystem II protein M (plastid)
           [Hanguana malayana] YP_009248430.1 photosystem II
           protein M (plastid) [Eugeissona tristis] YP_009248512.1
           photosystem II protein M (plastid) [Eremospatha
           macrocarpa] YP_009248598.1 photosystem II protein M
           (plastid) [Corypha lecomtei] YP_009248684.1 photosystem
           II protein M (plastid) [Chuniophoenix nana]
           YP_009248770.1 photosystem II protein M (plastid)
           [Chamaerops humilis] YP_009248856.1 photosystem II
           protein M (plastid) [Brahea brandegeei] YP_009248942.1
           photosystem II protein M (plastid) [Borassodendron
           machadonis] YP_009249028.1 photosystem II protein M
           (plastid) [Baxteria australis] YP_009249114.1
           photosystem II protein M (plastid) [Arenga caudata]
           YP_009249200.1 photosystem II protein M (plastid) [Areca
           vestiaria] YP_009249279.1 photosystem II protein M
           (plastid) [Acoelorraphe wrightii] YP_009249365.1
           photosystem II protein M (plastid) [Washingtonia
           robusta] YP_009250859.1 photosystem II protein M
           (chloroplast) [Iochroma umbellatum] YP_009250976.1
           photosystem II protein M (plastid) [Geranium incanum]
           YP_009251230.1 photosystem II protein M (chloroplast)
           [Acnistus arborescens x Iochroma cyaneum] YP_009251638.1
           photosystem II protein M (chloroplast) [Colchicum
           autumnale] YP_009251724.1 photosystem II protein M
           (chloroplast) [Gloriosa superba] YP_009252484.1
           photosystem II protein M (plastid) [Annona cherimola]
           YP_009252586.1 photosystem II protein M (chloroplast)
           [Iochroma lehmannii] YP_009252669.1 photosystem II
           protein M (chloroplast) [Iochroma salpoanum]
           YP_009252842.1 photosystem II protein M (chloroplast)
           [Eriolarynx fasciculata] YP_009252935.1 photosystem II
           protein M (chloroplast) [Helianthus debilis]
           YP_009253067.1 photosystem II protein M (chloroplast)
           [Iochroma ellipticum] YP_009253151.1 photosystem II
           protein M (chloroplast) [Iochroma cyaneum]
           YP_009253244.1 photosystem II protein M (chloroplast)
           [Bruinsmia polysperma] YP_009253382.1 photosystem II
           protein M (chloroplast) [Acnistus arborescens]
           YP_009254072.1 PsbM (plastid) [Solanum melongena]
           YP_009254209.1 photosystem II protein M (chloroplast)
           [Erythranthe lutea] YP_009255600.1 PSII M protein
           (chloroplast) [Cornus controversa] YP_009255861.1
           photosystem II protein M (chloroplast) [Helianthus
           argophyllus] YP_009256028.1 photosystem II protein M
           (chloroplast) [Scopolia parviflora] YP_009256227.1
           photosystem II protein M (chloroplast) [Oryza minuta]
           YP_009258162.1 PSII low MW protein (chloroplast)
           [Arabidopsis suecica] YP_009261474.1 photosystem II
           protein M (chloroplast) [Liriodendron chinense]
           YP_009266410.1 photosystem II protein M (chloroplast)
           [Oryza brachyantha] YP_009262857.1 PsbM (chloroplast)
           [Capsicum chinense] YP_009269555.1 photosystem II
           protein M (chloroplast) [Cephalanthera longifolia]
           YP_009270039.1 photosystem II protein M (chloroplast)
           [Listera fugongensis] YP_009269641.1 photosystem II
           protein M (chloroplast) [Epipactis mairei]
           YP_009269838.1 photosystem II protein M (chloroplast)
           [Epipactis veratrifolia] YP_009269954.1 photosystem II
           protein M (chloroplast) [Neottia pinetorum]
           YP_009270125.1 photosystem II protein M (chloroplast)
           [Neottia ovata] YP_009270906.1 PsbM (chloroplast)
           [Perilla setoyensis] YP_009271290.1 photosystem II
           protein M (chloroplast) [Amaranthus hypochondriacus]
           YP_009272242.1 photosystem II protein M (chloroplast)
           [Diospyros oleifera] YP_009272342.1 photosystem II
           protein M (chloroplast) [Diospyros kaki] YP_009270730.1
           PsbM (chloroplast) [Perilla citriodora] YP_009270818.1
           PsbM (chloroplast) [Perilla frutescens] YP_009271032.1
           photosystem II M protein (chloroplast) [Aconitum
           carmichaelii] YP_009271176.1 photosystem II protein M
           (chloroplast) [Ampelocalamus naibunensis] YP_009271455.1
           PsbM (chloroplast) [Eclipta prostrata] YP_009271892.1
           PsbM (chloroplast) [Carthamus tinctorius] YP_009271984.1
           photosystem II protein M (chloroplast) [Diospyros
           glaucifolia] YP_009272155.1 photosystem II protein M
           (chloroplast) [Diospyros lotus] YP_009272489.1
           photosystem II protein M (chloroplast) [Utricularia
           reniformis] YP_009294857.1 photosystem II protein M
           (plastid) [Veronica nakaiana] YP_009298354.1 photosystem
           II protein M (chloroplast) [Actinidia polygama]
           YP_009298437.1 photosystem II protein M (chloroplast)
           [Actinidia tetramera] YP_009305292.1 PsbM (chloroplast)
           [Oryza sativa] YP_009295098.1 photosystem II protein M
           (chloroplast) [Ipomoea nil] YP_009305543.1 photosystem
           II protein M (plastid) [Veronica persica] YP_009305629.1
           photosystem II protein M (plastid) [Veronicastrum
           sibiricum] YP_009305909.1 photosystem II protein M
           (chloroplast) [Quercus variabilis] YP_009305995.1
           photosystem II protein M (chloroplast) [Quercus
           dolicholepis] YP_009306464.1 photosystem II protein M
           (chloroplast) [Helwingia himalaica] YP_009306771.1
           photosystem II protein M (chloroplast) [Davidia
           involucrata] YP_009308072.1 photosystem II M protein
           (chloroplast) [Aconitum austrokoreense] YP_009308469.1
           photosystem II proteinM (chloroplast) [Aconitum ciliare]
           YP_009308555.1 photosystem II proteinM (chloroplast)
           [Aconitum coreanum] YP_009308640.1 photosystem II
           proteinM (chloroplast) [Aconitum kusnezoffii]
           YP_009308725.1 photosystem II proteinM (chloroplast)
           [Aconitum monanthum] YP_009308997.1 photosystem II
           protein M (chloroplast) [Joinvillea ascendens]
           YP_009309271.1 PSII M protein (chloroplast) [Pogostemon
           yatabeanus] YP_009309358.1 PSII M protein (chloroplast)
           [Pogostemon stellatus] YP_009309445.1 PSII M protein
           (chloroplast) [Paulownia coreana] YP_009309532.1 PSII M
           protein (chloroplast) [Paulownia tomentosa]
           YP_009309868.1 PSII M protein (chloroplast)
           [Abeliophyllum distichum] YP_009309955.1 PSII low MW
           protein M (chloroplast) [Coreanomecon hylomeconoides]
           YP_009310512.1 photosystem II protein M (chloroplast)
           [Cabomba caroliniana] YP_009312609.1 PsbM (chloroplast)
           [Avena sterilis] YP_009312697.1 photosystem II protein M
           (chloroplast) [Ranunculus occidentalis] YP_009317903.1
           photosystem II protein M (chloroplast) [Haberlea
           rhodopensis] YP_009316307.1 photosystem II protein M
           (plastid) [Castilleja paramensis] YP_009316972.1
           photosystem II protein M (chloroplast) [Nymphaea
           jamesoniana] YP_009317286.1 photosystem II protein M
           (chloroplast) [Mikania micrantha] YP_009317793.1
           photosystem II protein M (chloroplast) [Trollius
           chinensis] YP_009318533.1 photosystem II protein M
           (chloroplast) [Dracocephalum palmatum] YP_009319989.1
           photosystem II protein M (plastid) [Alniphyllum
           eberhardtii] YP_009317982.1 photosystem II protein M
           (chloroplast) [Galinsoga quadriradiata] YP_009327381.1
           photosystem II M protein (chloroplast) [Mentha
           longifolia] YP_009334399.1 photosystem II protein M
           (chloroplast) [Albuca kirkii] YP_009336371.1 photosystem
           II protein M (chloroplast) [Nicotiana otophora]
           YP_009338155.1 photosystem II M protein (chloroplast)
           [Gymnaconitum gymnandrum] YP_009338624.1 PSII low MW
           protein M (chloroplast) [Averrhoa carambola]
           YP_009338746.1 PSII low MW protein M (chloroplast)
           [Carissa macrocarpa] YP_009341867.1 photosystem II
           protein M (chloroplast) [Aletris spicata] YP_009341952.1
           photosystem II protein M (chloroplast) [Aletris fauriei]
           YP_009344244.1 PsbM (chloroplast) [Capsicum eximium]
           YP_009342756.1 PSII low MW protein M (chloroplast)
           [Pouteria campechiana] YP_009342841.1 PSII low MW
           protein M (chloroplast) [Diospyros blancoi]
           YP_009343983.1 PsbM (chloroplast) [Capsicum
           galapagoense] YP_009344070.1 PsbM (chloroplast)
           [Capsicum chacoense] YP_009344157.1 PsbM (chloroplast)
           [Capsicum tovarii] YP_009344430.1 PSII M protein
           (chloroplast) [Rehmannia chingii] YP_009342926.1
           photosystem II protein M (chloroplast) [Carpinus
           putoensis] AP_004922.1 photosystem II protein M
           (chloroplast) [Solanum lycopersicum] P62109.1 RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M P62111.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M P62112.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q5IBK3.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q6ENI6.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q6EW54.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q7FNT0.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q06H03.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q06RD7.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q09G52.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q1KXX3.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q2MIA6.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q2MIJ3.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q2VEI2.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q33C43.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q3BAP6.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q3C1G4.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M Q3V540.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M Q0G9M5.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M P0C411.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M P0C412.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M P0C413.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A7Y3C1.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A4QJS7.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A4QK99.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A4QKI6.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A4QKS5.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A4QLA0.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A4QLS7.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A9L990.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A6MM30.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A6MMB6.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A6MMK1.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A6MMT8.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M 3JCU_M Chain M,
           Cryo-em Structure Of Spinach Psii-lhcii Supercomplex At
           3.2 Angstrom Resolution 3JCU_MM Chain m, Cryo-em
           Structure Of Spinach Psii-lhcii Supercomplex At 3.2
           Angstrom Resolution AAM08591.1 Putative PSII low MW
           protein from chromosome 10 chloroplast insertion [Oryza
           sativa Japonica Group] AAM48256.1 Putative PSII low MW
           protein from chromosome 10 chloroplast insertion [Oryza
           sativa Japonica Group] CAA33984.1 PSII low MW protein
           (chloroplast) [Oryza sativa Japonica Group] CAA77413.1
           PSII M-protein (chloroplast) [Nicotiana tabacum]
           BAA84379.1 PSII low MW protein (chloroplast)
           [Arabidopsis thaliana] CAB88719.1 PSII M-protein
           (chloroplast) [Spinacia oleracea] CAC88038.1 PSII M
           protein (chloroplast) [Atropa belladonna] CAD36619.1
           photosystem II polypeptide M [Quercus petraea]
           BAD26766.1 PSII low MW protein (chloroplast) [Oryza
           nivara] CAF28587.1 PSII low MW protein (chloroplast)
           [Nymphaea alba] AAW33074.1 photosystem II protein M
           (chloroplast) [Plantago australis] AAW33076.1
           photosystem II protein M (chloroplast) [Plantago
           coronopus] AAW33078.1 photosystem II protein M
           (chloroplast) [Plantago lanceolata] AAW33080.1
           photosystem II protein M (chloroplast) [Plantago media]
           AAW33082.1 photosystem II protein M (chloroplast)
           [Plantago rigida] AAW33084.1 photosystem II protein M
           (chloroplast) [Plantago rugelii] AAW82497.1 photosystem
           II M protein (chloroplast) [Phalaenopsis aphrodite
           subsp. formosana] AAZ04027.1 photosystem II protein M,
           partial (chloroplast) [Acorus americanus] AAZ04029.1
           photosystem II protein M, partial (chloroplast) [Nuphar
           advena] AAZ04030.1 photosystem II protein M, partial
           (chloroplast) [Ranunculus macranthus] AAZ04031.1
           photosystem II protein M, partial (chloroplast) [Typha
           latifolia] AAZ66142.1 PsbM (chloroplast) [Symplocos
           chinensis] AAZ66144.1 PsbM (chloroplast) [Symplocos
           paniculata] AAZ66148.1 PsbM (chloroplast) [Symplocos
           celastrinea] AAZ66152.1 PsbM (chloroplast) [Symplocos
           pentandra] AAZ66156.1 PsbM (chloroplast) [Symplocos
           tinctoria] AAZ66158.1 PsbM (chloroplast) [Symplocos
           lanata] AAZ66162.1 PsbM (chloroplast) [Symplocos
           austin-smithii] AAZ66164.1 PsbM (chloroplast) [Symplocos
           austin-smithii] AAZ66166.1 PsbM (chloroplast) [Symplocos
           austromexicana] AAZ66168.1 PsbM (chloroplast) [Symplocos
           berteroi] AAZ66170.1 PsbM (chloroplast) [Symplocos
           breedlovei] AAZ66172.1 PsbM (chloroplast) [Symplocos
           citrea] AAZ66174.1 PsbM (chloroplast) [Symplocos
           coccinea] AAZ66176.1 PsbM (chloroplast) [Symplocos
           costaricana] AAZ66178.1 PsbM (chloroplast) [Symplocos
           fuscata] AAZ66180.1 PsbM (chloroplast) [Symplocos
           hartwegii] AAZ66182.1 PsbM (chloroplast) [Symplocos
           limoncillo] AAZ66184.1 PsbM (chloroplast) [Symplocos
           martinicensis] AAZ66186.1 PsbM (chloroplast) [Symplocos
           matudae] AAZ66188.1 PsbM (chloroplast) [Symplocos
           nitens] AAZ66190.1 PsbM (chloroplast) [Symplocos
           povedae] AAZ66196.1 PsbM (chloroplast) [Symplocos
           reflexa] AAZ66198.1 PsbM (chloroplast) [Symplocos
           serrulata] AAZ66204.1 PsbM (chloroplast) [Symplocos sp.
           Clark et al. 8252] AAZ66208.1 PsbM (chloroplast)
           [Symplocos striata] AAZ66210.1 PsbM (chloroplast)
           [Symplocos sulcinervia] AAZ66214.1 PsbM (chloroplast)
           [Symplocos tribracteolata] AAZ66216.1 PsbM (chloroplast)
           [Symplocos uniflora] AAZ66218.1 PsbM (chloroplast)
           [Symplocos verrucisurcula] AAZ66220.1 PsbM (chloroplast)
           [Symplocos candelabra] AAZ66222.1 PsbM (chloroplast)
           [Symplocos falcata] AAZ66224.1 PsbM (chloroplast)
           [Symplocos falcata] AAZ66226.1 PsbM (chloroplast)
           [Symplocos organensis] AAZ66228.1 PsbM (chloroplast)
           [Symplocos microstyla] AAZ66232.1 PsbM (chloroplast)
           [Symplocos dryophila] AAZ66234.1 PsbM (chloroplast)
           [Symplocos lancifolia] AAZ66236.1 PsbM (chloroplast)
           [Symplocos macrophylla] AAZ66242.1 PsbM (chloroplast)
           [Symplocos ovatilobata] AAZ66252.1 PsbM (chloroplast)
           [Symplocos phyllocalyx] AAZ66254.1 PsbM (chloroplast)
           [Symplocos setchuensis] AAZ66256.1 PsbM (chloroplast)
           [Symplocos tetragona] AAZ66258.1 PsbM (chloroplast)
           [Symplocos arborea] AAZ66268.1 PsbM (chloroplast)
           [Symplocos sumuntia] AAZ66272.1 PsbM (chloroplast)
           [Symplocos adenophylla] AAZ66274.1 PsbM (chloroplast)
           [Symplocos congesta] AAZ66276.1 PsbM (chloroplast)
           [Symplocos euryoides] AAZ66282.1 PsbM (chloroplast)
           [Symplocos glomerata] AAZ66284.1 PsbM (chloroplast)
           [Symplocos grandis] AAZ66286.1 PsbM (chloroplast)
           [Symplocos stellaris] AAZ66288.1 PsbM (chloroplast)
           [Symplocos caerulescens] CAI53788.1 PSII low MW protein
           (plastid) [Acorus calamus] BAE46642.1 PSII M-protein
           (chloroplast) [Nicotiana sylvestris] BAE47992.1 PSII
           M-protein (chloroplast) [Nicotiana tomentosiformis]
           ABB90037.1 photosystem II M protein (chloroplast)
           [Solanum tuberosum] ABC56207.1 photosystem II protein M
           (chloroplast) [Solanum bulbocastanum] ABC56294.1
           photosystem II protein M (chloroplast) [Solanum
           lycopersicum] ABC60452.1 photosystem II protein M
           (chloroplast) [Nuphar advena] ABC70750.1 photosystem II
           protein M (chloroplast) [Ranunculus macranthus]
           ABD47051.1 photosystem II protein M (chloroplast)
           [Solanum tuberosum] ABD47132.1 photosystem II protein M
           (chloroplast) [Helianthus annuus] ABD48489.1 PSII M
           protein (chloroplast) [Lemna minor] CAJ32387.1
           photosystem II protein M (chloroplast) [Solanum
           lycopersicum] ABG74622.1 PSII M protein (chloroplast)
           [Jasminum nudiflorum] ABH88291.1 photosystem II protein
           M (chloroplast) [Drimys granadensis] ABI32503.1
           photosystem II protein M (chloroplast) [Liriodendron
           tulipifera] ABI49772.1 photosystem II protein M
           (chloroplast) [Platanus occidentalis] BAF49933.1 PSII
           low MW protein (chloroplast) [Olimarabidopsis pumila]
           BAF50104.1 PSII low MW protein (chloroplast) [Barbarea
           verna] BAF50191.1 PSII low MW protein (chloroplast)
           [Capsella bursa-pastoris] BAF50280.1 PSII low MW protein
           (chloroplast) [Crucihimalaya wallichii] BAF50455.1 PSII
           low MW protein (chloroplast) [Lepidium virginicum]
           BAF50632.1 PSII low MW protein (chloroplast) [Nasturtium
           officinale] ABQ43254.1 photosystem II protein M
           (chloroplast) [Chloranthus spicatus] ABQ45243.1
           photosystem II protein M (chloroplast) [Buxus
           microphylla] ABQ52513.1 photosystem II protein M
           (chloroplast) [Illicium oligandrum] ABR01424.1
           photosystem II protein M (chloroplast) [Dioscorea
           elephantipes] ABU85342.1 photosystem II protein M,
           partial (chloroplast) [Elaeis oleifera] ABU85434.1
           photosystem II protein M, partial (chloroplast) [Musa
           acuminata] ABU85580.1 photosystem II protein M, partial
           (chloroplast) [Scaevola aemula] ABV02342.1 photosystem
           II protein M (chloroplast) [Ipomoea purpurea] ABX38738.1
           photosystem II protein M (chloroplast) [Acorus
           americanus] ABY79726.1 photosystem II protein M
           (chloroplast) [Fagopyrum esculentum subsp. ancestrale]
           ACB86513.1 photosystem II protein M (chloroplast)
           [Guizotia abyssinica] ACN49317.1 photosystem II protein
           M (chloroplast) [Nelumbo lutea] ACN49402.1 photosystem
           II protein M (chloroplast) [Nelumbo nucifera] ACO92009.1
           photosystem II protein M (chloroplast) [Megaleranthis
           saniculifolia] ACS94666.1 PsbM (chloroplast) [Bambusa
           oldhamii] ACT15394.1 photosystem II protein M
           (chloroplast) [Anomochloa marantoidea] ACT99908.1
           photosystem II protein M (chloroplast) [Dendrocalamus
           latiflorus] ADA63693.1 photosystem II protein M
           (chloroplast) [Typha latifolia] ADA69920.1 photosystem
           II protein M (chloroplast) [Olea europaea] ADD30417.1
           photosystem II protein M (chloroplast) [Antirrhinum
           majus] ADD30419.1 photosystem II protein M (chloroplast)
           [Dillenia indica] ADD30420.1 photosystem II protein M
           (chloroplast) [Ehretia acuminata] ADD30421.1 photosystem
           II protein M (chloroplast) [Ilex cornuta] ADD30423.1
           photosystem II protein M (chloroplast) [Meliosma aff.
           cuneifolia Moore 333] ADD30424.1 photosystem II protein
           M (chloroplast) [Nelumbo nucifera] ADD30425.1
           photosystem II protein M (chloroplast) [Nerium oleander]
           ADD30429.1 photosystem II protein M (chloroplast)
           [Berberidopsis corallina] ADD30434.1 photosystem II
           protein M (chloroplast) [Gunnera manicata] ADD30437.1
           photosystem II protein M (chloroplast) [Oxalis
           latifolia] ADD30439.1 photosystem II protein M
           (chloroplast) [Quercus nigra] ADD30441.1 photosystem II
           protein M (chloroplast) [Trochodendron aralioides]
           ADD63166.1 photosystem II protein M (chloroplast)
           [Phoenix dactylifera] ADD72083.1 photosystem II protein
           M (chloroplast) [Olea europaea] ADF28140.1 photosystem
           II protein M (chloroplast) [Phoenix dactylifera]
           ADL39050.1 photosystem II protein M (chloroplast)
           [Magnolia kwangsiensis] ADN32880.1 photosystem II
           protein M (chloroplast) [Phyllostachys nigra var.
           henonis] ADO33442.1 photosystem II protein M (plastid)
           [Smilax china] ADO65054.1 photosystem II protein M
           (chloroplast) [Castanea mollissima] ADO65131.1
           photosystem II protein M (chloroplast) [Acidosasa
           purpurea] ADO65214.1 photosystem II protein M (plastid)
           [Ferrocalamus rimosivaginus] ADO65297.1 photosystem II
           protein M (plastid) [Indocalamus longiauritus]
           ADO65379.1 photosystem II protein M (chloroplast)
           [Phyllostachys edulis] ADO65463.1 photosystem II protein
           M (chloroplast) [Bambusa emeiensis] BAJ24022.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24023.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24024.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24025.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24026.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24027.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24028.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24029.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24030.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24031.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24032.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24033.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24034.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24035.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24036.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24037.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24038.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24039.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24040.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24041.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24042.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24043.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24044.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24045.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24046.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24047.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24048.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24049.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24050.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24051.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24052.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24053.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24054.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24055.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24056.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24057.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24058.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24059.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24060.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24061.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24062.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24063.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24064.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24065.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24066.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24067.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24068.1
           photosystem II protein M (chloroplast) [Lysionotus
           pauciflorus] BAJ24069.1 photosystem II protein M
           (chloroplast) [Lysionotus pauciflorus] BAJ24070.1
           photosystem II protein M (chloroplast) [Lysionotus
           chingii] BAJ24071.1 photosystem II protein M
           (chloroplast) [Lysionotus chingii] BAJ24072.1
           photosystem II protein M (chloroplast) [Lysionotus
           chingii] BAJ24073.1 photosystem II protein M
           (chloroplast) [Lysionotus oblongifolius] BAJ24074.1
           photosystem II protein M (chloroplast) [Lysionotus
           oblongifolius] BAJ24075.1 photosystem II protein M
           (chloroplast) [Lysionotus oblongifolius] BAJ24076.1
           photosystem II protein M (chloroplast) [Lysionotus
           denticulosus] BAJ24077.1 photosystem II protein M
           (chloroplast) [Lysionotus denticulosus] BAJ24078.1
           photosystem II protein M (chloroplast) [Lysionotus
           serratus] ADW94715.1 PsbM (plastid) [Streptocarpus
           papangae] ADW94717.1 PsbM (plastid) [Streptocarpus
           montanus] ADW94719.1 PsbM (plastid) [Streptocarpus
           fanniniae] ADW94720.1 PsbM (plastid) [Streptocarpus
           pusillus] ADW94722.1 PsbM (plastid) [Streptocarpus
           dunnii] ADW94724.1 PsbM (plastid) [Streptocarpus dunnii]
           ADW94726.1 PsbM (plastid) [Streptocarpus dunnii]
           ADW94728.1 PsbM (plastid) [Streptocarpus dunnii]
           ADW94730.1 PsbM (plastid) [Streptocarpus dunnii]
           ADW94732.1 PsbM (plastid) [Streptocarpus dunnii]
           ADW94734.1 PsbM (plastid) [Streptocarpus dunnii]
           ADW94736.1 PsbM (plastid) [Streptocarpus denticulatus]
           ADW94738.1 PsbM (plastid) [Streptocarpus denticulatus]
           ADW94740.1 PsbM (plastid) [Streptocarpus grandis]
           ADW94742.1 PsbM (plastid) [Streptocarpus grandis]
           ADW94744.1 PsbM (plastid) [Streptocarpus vandeleurii]
           ADW94746.1 PsbM (plastid) [Streptocarpus vandeleurii]
           ADW94748.1 PsbM (plastid) [Streptocarpus rimicola]
           ADW94750.1 PsbM (plastid) [Streptocarpus rimicola]
           ADW94752.1 PsbM (plastid) [Streptocarpus bolusii]
           ADW94754.1 PsbM (plastid) [Streptocarpus bolusii]
           ADW94756.1 PsbM (plastid) [Streptocarpus
           porphyrostachys] ADW94757.1 PsbM (plastid)
           [Streptocarpus polyanthus] ADW94759.1 PsbM (plastid)
           [Streptocarpus saundersii] ADW94761.1 PsbM (plastid)
           [Streptocarpus candidus] ADW94763.1 PsbM (plastid)
           [Streptocarpus gardenii] ADW94765.1 PsbM (plastid)
           [Streptocarpus gardenii] ADW94767.1 PsbM (plastid)
           [Streptocarpus gardenii] ADW94769.1 PsbM (plastid)
           [Streptocarpus gardenii] ADW94771.1 PsbM (plastid)
           [Streptocarpus gardenii] ADW94773.1 PsbM (plastid)
           [Streptocarpus gardenii] ADW94774.1 PsbM (plastid)
           [Streptocarpus kentaniensis] ADW94776.1 PsbM (plastid)
           [Streptocarpus lilliputana] ADW94778.1 PsbM (plastid)
           [Streptocarpus lilliputana] ADW94780.1 PsbM (plastid)
           [Streptocarpus aylae] ADW94782.1 PsbM (plastid)
           [Streptocarpus caeruleus] ADW94784.1 PsbM (plastid)
           [Streptocarpus caeruleus] ADW94786.1 PsbM (plastid)
           [Streptocarpus longiflorus] ADW94788.1 PsbM (plastid)
           [Streptocarpus parviflorus] ADW94790.1 PsbM (plastid)
           [Streptocarpus parviflorus subsp. parviflorus]
           ADW94792.1 PsbM (plastid) [Streptocarpus cyaneus subsp.
           nigridens] ADW94794.1 PsbM (plastid) [Streptocarpus
           cyaneus] ADW94796.1 PsbM (plastid) [Streptocarpus
           cyaneus] ADW94798.1 PsbM (plastid) [Streptocarpus
           floribundus] ADW94799.1 PsbM (plastid) [Streptocarpus
           meyeri] ADW94801.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94803.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94805.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94807.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94809.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94810.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94811.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94813.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94815.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94817.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94819.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94821.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94822.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94823.1 PsbM (plastid) [Streptocarpus meyeri]
           ADW94832.1 PsbM (plastid) [Streptocarpus baudertii]
           ADW94834.1 PsbM (plastid) [Streptocarpus johannis]
           ADW94836.1 PsbM (plastid) [Streptocarpus johannis]
           ADW94837.1 PsbM (plastid) [Streptocarpus johannis]
           ADW94838.1 PsbM (plastid) [Streptocarpus johannis]
           ADW94840.1 PsbM (plastid) [Streptocarpus modestus]
           ADW94842.1 PsbM (plastid) [Streptocarpus modestus]
           ADW94844.1 PsbM (plastid) [Streptocarpus formosus]
           ADW94846.1 PsbM (plastid) [Streptocarpus formosus]
           ADW94848.1 PsbM (plastid) [Streptocarpus formosus]
           ADW94850.1 PsbM (plastid) [Streptocarpus formosus]
           ADW94852.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94854.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94856.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94858.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94860.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94862.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94864.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94865.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94866.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94867.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94868.1 PsbM (plastid) [Streptocarpus primulifolius]
           ADW94869.1 PsbM (plastid) [Streptocarpus rexii]
           ADW94870.1 PsbM (plastid) [Streptocarpus rexii]
           ADW94871.1 PsbM (plastid) [Streptocarpus rexii]
           ADW94872.1 PsbM (plastid) [Streptocarpus rexii]
           ADZ10863.1 photosystem II protein M (chloroplast)
           [Elaeis guineensis] CBR30309.1 photosystem II protein M
           (plastid) [Olea europaea subsp. europaea] AEB72133.1
           photosystem II protein M (chloroplast) [Solanum
           tuberosum] AEB72219.1 photosystem II protein M
           (chloroplast) [Solanum tuberosum] AEB96294.1 photosystem
           II protein M (chloroplast) [Phalaenopsis equestris]
           AEC03997.1 photosystem II protein M (chloroplast)
           [Silene conica] AEC04078.1 photosystem II protein M
           (chloroplast) [Silene latifolia] AEC04159.1 photosystem
           II protein M (chloroplast) [Silene noctiflora]
           AEC04241.1 photosystem II protein M (chloroplast)
           [Silene vulgaris] CBR23823.1 photosystem II protein M
           (chloroplast) [Olea europaea subsp. cuspidata]
           CBR24614.1 photosystem II protein M (chloroplast) [Olea
           europaea subsp. europaea] CBR30400.1 photosystem II
           protein M (plastid) [Olea europaea subsp. europaea]
           CBS29344.1 photosystem II protein M (chloroplast) [Olea
           woodiana subsp. woodiana] CBS29231.1 photosystem II
           protein M (chloroplast) [Olea europaea subsp. maroccana]
           CBJ04292.1 photosystem II protein M (chloroplast) [Olea
           europaea subsp. cuspidata] CBR23732.1 photosystem II
           protein M (chloroplast) [Olea europaea subsp. cuspidata]
           AEG64542.1 photosystem II protein M (chloroplast)
           [Ageratina adenophora] AEI53005.1 photosystem II protein
           M (chloroplast) [Oryza meridionalis] AEI53080.1
           photosystem II protein M (chloroplast) [Oryza rufipogon]
           AEI53157.1 photosystem II protein M (chloroplast) [Oryza
           rufipogon] AEI70794.1 photosystem II protein M
           (chloroplast) [Puelia olyriformis] AEK48400.1
           photosystem II protein M (chloroplast) [Colocasia
           esculenta] AEK48486.1 photosystem II protein M
           (chloroplast) [Colocasia esculenta] AEK53223.1
           photosystem II protein M (chloroplast) [Dorcoceras
           hygrometricum] AEK94336.1 photosystem II protein M
           (chloroplast) [Spirodela polyrhiza] AEK94419.1
           photosystem II protein M (chloroplast) [Wolffiella
           lingulata] AEK94502.1 photosystem II protein M
           (chloroplast) [Wolffia australiana] AEM65212.1 PsbM
           (chloroplast) [Magnolia denudata] AEO21166.1 photosystem
           II protein M (plastid) [Leersia tisserantii] AEO21249.1
           photosystem II protein M (chloroplast) [Phyllostachys
           propinqua] AEO21332.1 photosystem II protein M (plastid)
           [Rhynchoryza subulata] AEO92700.1 PSII M protein
           (chloroplast) [Sesamum indicum] AEO95554.1 photosystem
           II protein M (chloroplast) [Nicotiana undulata]
           AEO95664.1 photosystem II protein M [synthetic
           construct] AEQ36932.1 photosystem II M protein
           (chloroplast) [Datura stramonium] AEQ37018.1 photosystem
           II M protein (chloroplast) [Datura stramonium]
           AER12808.1 photosystem II protein M (chloroplast) [Oryza
           sativa Indica Group] AER12973.1 photosystem II protein M
           (chloroplast) [Oryza sativa Indica Group] BAL04669.1
           photosystem II reaction center protein M (chloroplast)
           [Isodon shikokianus var. occidentalis] BAL04671.1
           photosystem II reaction center protein M (chloroplast)
           [Isodon shikokianus var. intermedius] BAL04673.1
           photosystem II reaction center protein M (chloroplast)
           [Isodon japonicus] BAL04675.1 photosystem II reaction
           center protein M (chloroplast) [Isodon trichocarpus]
           BAL04677.1 photosystem II reaction center protein M
           (chloroplast) [Isodon effusus] BAL04679.1 photosystem II
           reaction center protein M (chloroplast) [Isodon
           shikokianus var. intermedius] BAL04681.1 photosystem II
           reaction center protein M (chloroplast) [Isodon effusus]
           BAL04683.1 photosystem II reaction center protein M
           (chloroplast) [Isodon umbrosus] BAL04685.1 photosystem
           II reaction center protein M (chloroplast) [Isodon
           trichocarpus] BAL04687.1 photosystem II reaction center
           protein M (chloroplast) [Isodon inflexus] BAL04689.1
           photosystem II reaction center protein M (chloroplast)
           [Isodon inflexus] BAL04691.1 photosystem II reaction
           center protein M (chloroplast) [Isodon shikokianus var.
           occidentalis] BAL04693.1 photosystem II reaction center
           protein M (chloroplast) [Isodon longitubus] BAL04695.1
           photosystem II reaction center protein M (chloroplast)
           [Isodon japonicus] BAL04697.1 photosystem II reaction
           center protein M (chloroplast) [Isodon excisus]
           BAL04699.1 photosystem II reaction center protein M
           (chloroplast) [Isodon longitubus] AEX37335.1 photosystem
           II protein M (chloroplast) [Arbutus unedo] AEX65388.1
           photosystem II protein M, partial (chloroplast)
           [Blossfeldia liliputana] AEX65389.1 photosystem II
           protein M, partial (chloroplast) [Didierea
           madagascariensis] AEX65391.1 photosystem II protein M,
           partial (chloroplast) [Mollugo verticillata] AEX65394.1
           photosystem II protein M, partial (chloroplast)
           [Pereskiopsis diguetii] AEX98328.1 photosystem II M
           protein (chloroplast) [Magnolia denudata] AEX98496.1
           photosystem II M protein (chloroplast) [Magnolia
           officinalis] AEX98578.1 photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           AEX98662.1 photosystem II M protein (chloroplast)
           [Magnolia officinalis subsp. biloba] AEX98746.1
           photosystem II M protein (chloroplast) [Magnolia
           officinalis subsp. biloba] AEX98913.1 photosystem II M
           protein (chloroplast) [Magnolia grandiflora] AEX99081.1
           photosystem II M protein (chloroplast) [Magnolia
           grandiflora] AEY84646.1 photosystem II protein M
           (chloroplast) [Elodea canadensis] AEZ01421.1 photosystem
           II protein M (chloroplast) [Japonolirion osense]
           AFA26836.1 photosystem II protein M (plastid) [Albuca
           kirkii] AFA26839.1 photosystem II protein M, partial
           (plastid) [Belosynapsis ciliata] AFA26840.1 photosystem
           II protein M, partial (plastid) [Brocchinia micrantha]
           AFA26841.1 photosystem II protein M (plastid)
           [Centrolepis monogyna] AFA26842.1 photosystem II protein
           M, partial (plastid) [Chamaedorea seifrizii] AFA26845.1
           photosystem II protein M (plastid) [Dasypogon
           bromeliifolius] AFA26849.1 photosystem II protein M,
           partial (plastid) [Fosterella caulescens] AFA26855.1
           photosystem II protein M (plastid) [Juncus effusus]
           AFA26856.1 photosystem II protein M, partial (plastid)
           [Kingia australis] AFA26859.1 photosystem II protein M,
           partial (plastid) [Navia saxicola] AFA26861.1
           photosystem II protein M, partial (plastid) [Neoregelia
           carolinae] AFA26865.1 photosystem II protein M, partial
           (plastid) [Pitcairnia feliciana] AFA26866.1 photosystem
           II protein M, partial (plastid) [Potarophytum riparium]
           AFA26867.1 photosystem II protein M, partial (plastid)
           [Puya laxa] AFA26868.1 photosystem II protein M, partial
           (plastid) [Ravenea hildebrandtii] AFA26869.1 photosystem
           II protein M, partial (plastid) [Renealmia alpinia]
           AFA26870.1 photosystem II protein M, partial (plastid)
           [Sparganium eurycarpum] AFA26871.1 photosystem II
           protein M (plastid) [Syngonanthus chrysanthus]
           AFA26872.1 photosystem II protein M (plastid)
           [Thamnochortus insignis] AFA26874.1 photosystem II
           protein M, partial (plastid) [Tradescantia ohiensis]
           AFH01441.1 photosystem II protein M (chloroplast)
           [Nelumbo nucifera] AFH01535.1 photosystem II protein M
           (chloroplast) [Nelumbo lutea] AFK81293.1 photosystem II
           protein M (plastid) [Camellia sinensis var. assamica]
           AFK81380.1 photosystem II protein M (plastid) [Camellia
           oleifera] AFK81467.1 photosystem II protein M (plastid)
           [Camellia taliensis] AFM83287.1 photosystem II protein M
           (chloroplast) [Kingia australis] AFM92273.1 photosystem
           II protein M (chloroplast) [Pachycladon cheesemanii]
           AFP90770.1 photosystem II protein M (chloroplast)
           [Capsicum annuum] AFP92303.1 photosystem II protein M
           (chloroplast) [Magnolia acuminata var. acuminata]
           AFP92389.1 photosystem II protein M (chloroplast)
           [Magnolia cathcartii] AFP92475.1 photosystem II protein
           M (chloroplast) [Magnolia dealbata] AFP92561.1
           photosystem II protein M (chloroplast) [Magnolia
           denudata] AFP92647.1 photosystem II protein M
           (chloroplast) [Magnolia pyramidata] AFP92733.1
           photosystem II protein M (chloroplast) [Magnolia kobus]
           AFP92819.1 photosystem II protein M (chloroplast)
           [Magnolia liliifera] AFP92903.1 photosystem II protein M
           (chloroplast) [Magnolia odora] AFP92991.1 photosystem II
           protein M (chloroplast) [Magnolia salicifolia]
           AFP93077.1 photosystem II protein M (chloroplast)
           [Magnolia sinica] AFP93163.1 photosystem II protein M
           (chloroplast) [Magnolia sprengeri] AFQ30923.1
           photosystem II M protein (chloroplast) [Salvia
           miltiorrhiza] AFR25654.1 photosystem II protein M
           (chloroplast) [Penthorum chinense] AFS67053.1
           photosystem II protein M (chloroplast) [Arundinaria
           fargesii] AFS67136.1 photosystem II protein M
           (chloroplast) [Sarocalamus faberi] AFS67220.1
           photosystem II protein M (chloroplast) [Chimonocalamus
           longiusculus] AFS67302.1 photosystem II protein M
           (chloroplast) [Fargesia nitida] AFS67385.1 photosystem
           II protein M (chloroplast) [Fargesia spathacea]
           AFS67468.1 photosystem II protein M (chloroplast)
           [Fargesia yunnanensis] AFS67551.1 photosystem II protein
           M (chloroplast) [Gaoligongshania megalothyrsa]
           AFS67634.1 photosystem II protein M (chloroplast)
           [Gelidocalamus tessellatus] AFS67717.1 photosystem II
           protein M (chloroplast) [Indocalamus wilsonii]
           AFS67800.1 photosystem II protein M (chloroplast)
           [Indosasa sinica] AFS67882.1 photosystem II protein M
           (chloroplast) [Oligostachyum shiuyingianum] AFS67964.1
           photosystem II protein M (chloroplast) [Pleioblastus
           maculatus] AFS68046.1 photosystem II protein M
           (chloroplast) [Thamnocalamus spathiflorus] AFS68129.1
           photosystem II protein M (chloroplast) [Yushania
           levigata] AFU93998.1 PsbM, partial (chloroplast)
           [Medusagyne oppositifolia] AFU94006.1 PsbM, partial
           (chloroplast) [Rhizophora mangle] AFV61808.1 PSII M
           protein (chloroplast) [Origanum vulgare subsp. vulgare]
           AFY64181.1 photosystem II protein M (chloroplast) [Najas
           flexilis] AGA55590.1 PSII M protein (chloroplast)
           [Camellia sinensis] CCP47124.1 photosystem II protein M
           (chloroplast) [Tectona grandis] CCP47213.1 photosystem
           II protein M (chloroplast) [Tectona grandis] CCP47302.1
           photosystem II protein M (chloroplast) [Tectona grandis]
           AGC31240.1 photosystem II protein M (plastid) [Quercus
           rubra] AGC38151.1 photosystem II protein M (chloroplast)
           [Arundinaria gigantea] AGE65744.1 photosystem II protein
           M (chloroplast) [Pharus lappulaceus] AGE92678.1
           photosystem II protein M (plastid) [Heliconia
           collinsiana] AGE92763.1 photosystem II protein M
           (plastid) [Zingiber spectabile] AGE92848.1 photosystem
           II protein M (plastid) [Pseudophoenix vinifera]
           AGE92934.1 photosystem II protein M (plastid) [Calamus
           caryotoides] AGE93020.1 photosystem II protein M
           (plastid) [Bismarckia nobilis] AGE93106.1 photosystem II
           protein M (plastid) [Dasypogon bromeliifolius]
           AGE93278.1 photosystem II protein M (plastid)
           [Chamaedorea seifrizii] AGE93364.1 photosystem II
           protein M (plastid) [Alpinia zerumbet] AGE93450.1
           photosystem II protein M (plastid) [Xiphidium caeruleum]
           CCJ32511.1 PsbM (chloroplast) [Trithuria inconspicua]
           AGH33761.1 photosystem II protein M (chloroplast)
           [Puelia olyriformis] AGI51138.1 photosystem II protein M
           (chloroplast) [Catharanthus roseus] AGJ51250.1
           photosystem II protein M (chloroplast) [Solanum
           carolinense] AGJ72051.1 photosystem II protein M
           (chloroplast) [Tetracentron sinense] AGJ72143.1
           photosystem II protein M (chloroplast) [Trochodendron
           aralioides] AGL45330.1 PsbM (chloroplast) [Sesamum
           indicum] AGL61069.1 photosystem II protein M
           (chloroplast) [Utricularia gibba] AGL81771.1 photosystem
           II protein M (plastid) [Streptocarpus cooksonii]
           AGL81773.1 photosystem II protein M (plastid)
           [Streptocarpus daviesii] AGL81775.1 photosystem II
           protein M (plastid) [Streptocarpus daviesii] AGL81777.1
           photosystem II protein M (plastid) [Streptocarpus
           grandis] AGL81779.1 photosystem II protein M (plastid)
           [Streptocarpus grandis] AGL81781.1 photosystem II
           protein M (plastid) [Streptocarpus grandis] AGL81783.1
           photosystem II protein M (plastid) [Streptocarpus
           grandis] AGL81785.1 photosystem II protein M (plastid)
           [Streptocarpus hilsenbergii] AGL81787.1 photosystem II
           protein M (plastid) [Streptocarpus huamboensis]
           AGL81789.1 photosystem II protein M (plastid)
           [Streptocarpus makabengensis] AGL81791.1 photosystem II
           protein M (plastid) [Streptocarpus sp. MdV-2012]
           AGL81793.1 photosystem II protein M (plastid)
           [Streptocarpus sp. MdV-2012] AGL81795.1 photosystem II
           protein M (plastid) [Streptocarpus molweniensis]
           AGL81797.1 photosystem II protein M (plastid)
           [Streptocarpus monophyllus] AGL81799.1 photosystem II
           protein M (plastid) [Streptocarpus occultus] AGL81801.1
           photosystem II protein M (plastid) [Streptocarpus
           saundersii] AGL81803.1 photosystem II protein M
           (plastid) [Streptocarpus wendlandii] AGL81805.1
           photosystem II protein M (plastid) [Streptocarpus
           wilmsii] AGL81807.1 photosystem II protein M (plastid)
           [Streptocarpus monophyllus] CCQ09096.1 photosystem II
           protein M (chloroplast) [Olea europaea subsp. europaea]
           AGN72208.1 photosystem II protein M (chloroplast)
           [Arundinaria appalachiana] AGN72291.1 photosystem II
           protein M (chloroplast) [Arundinaria tecta] AGN73974.1
           photosystem II M protein (chloroplast) [Aconitum
           barbatum var. puberulum] AGO98518.1 photosystem II
           protein M (chloroplast) [Nelumbo nucifera] AGQ55669.1
           photosystem II protein M (chloroplast) [Alstroemeria
           aurea] CCW72369.1 psbM (chloroplast) [Musa acuminata
           subsp. malaccensis] AGS43460.1 photosystem II protein M
           (chloroplast) [Cocos nucifera] AGT79840.1 PSII M protein
           (chloroplast) [Andrographis paniculata] AGU44293.1
           photosystem II protein M (chloroplast) [Camellia
           cuspidata] AGU44378.1 photosystem II protein M
           (chloroplast) [Camellia danzaiensis] AGU44469.1
           photosystem II protein M (chloroplast) [Camellia
           impressinervis] AGU44558.1 photosystem II protein M
           (chloroplast) [Camellia taliensis] AGU44647.1
           photosystem II protein M (chloroplast) [Camellia
           pitardii] AGU44736.1 photosystem II protein M
           (chloroplast) [Camellia yunnanensis] AGU44825.1
           photosystem II protein M (chloroplast) [Camellia
           taliensis] AGU46460.1 photosystem II protein M (plastid)
           [Hyoscyamus niger] AGW96331.1 photosystem II protein M
           (chloroplast) [Ipomoea batatas] AGW96416.1 photosystem
           II protein M (chloroplast) [Ipomoea batatas] AGW96501.1
           photosystem II protein M (chloroplast) [Ipomoea batatas]
           AGW96586.1 photosystem II protein M (chloroplast)
           [Ipomoea trifida] AGW96670.1 photosystem II protein M
           (chloroplast) [Argyreia nervosa] AGW96755.1 photosystem
           II protein M (chloroplast) [Ipomoea amnicola] AGW96840.1
           photosystem II protein M (chloroplast) [Ipomoea
           argillicola] AGW96925.1 photosystem II protein M
           (chloroplast) [Ipomoea cairica] AGW97010.1 photosystem
           II protein M (chloroplast) [Ipomoea diamantinensis]
           AGW97180.1 photosystem II protein M (chloroplast)
           [Ipomoea eriocarpa] AGW97265.1 photosystem II protein M
           (chloroplast) [Ipomoea hederifolia] AGW97350.1
           photosystem II protein M (chloroplast) [Ipomoea
           involucrata] AGW97435.1 photosystem II protein M
           (chloroplast) [Ipomoea murucoides] AGW97520.1
           photosystem II protein M (chloroplast) [Ipomoea nil]
           AGW97605.1 photosystem II protein M (chloroplast)
           [Ipomoea orizabensis] AGW97690.1 photosystem II protein
           M (chloroplast) [Ipomoea pedicellaris] AGW97775.1
           photosystem II protein M (chloroplast) [Ipomoea
           pes-caprae] AGW97860.1 photosystem II protein M
           (chloroplast) [Ipomoea polpha] AGW97945.1 photosystem II
           protein M (chloroplast) [Ipomoea setosa] AGW98029.1
           photosystem II protein M (chloroplast) [Ipomoea
           splendor-sylvae] AGW98114.1 photosystem II protein M
           (chloroplast) [Ipomoea ternifolia] AGW98199.1
           photosystem II protein M (chloroplast) [Ipomoea
           tricolor] AGW98284.1 photosystem II protein M
           (chloroplast) [Ipomoea trifida] AGW98369.1 photosystem
           II protein M (chloroplast) [Ipomoea cordatotriloba]
           AGW98454.1 photosystem II protein M (chloroplast)
           [Ipomoea minutiflora] AGW98539.1 photosystem II protein
           M (chloroplast) [Ipomoea obscura] AGW98624.1 photosystem
           II protein M (chloroplast) [Ipomoea pes-tigridis]
           AGW98709.1 photosystem II protein M (chloroplast)
           [Merremia quinquefolia] AGW98794.1 photosystem II
           protein M (chloroplast) [Operculina macrocarpa]
           AGW98879.1 photosystem II protein M (chloroplast)
           [Stictocardia macalusoi] AGW98964.1 photosystem II
           protein M (chloroplast) [Turbina corymbosa] AGX29600.1
           photosystem II protein M (chloroplast) [Aster
           spathulifolius] AGZ13228.1 photosystem II protein M
           (plastid) [Olyra latifolia] AGZ17999.1 photosystem II
           protein M (chloroplast) [Silene conoidea] AGZ18080.1
           photosystem II protein M (chloroplast) [Silene
           chalcedonica] AGZ18160.1 photosystem II protein M
           (chloroplast) [Silene paradoxa] AGZ19137.1 photosystem
           II protein M (chloroplast) [Camellia sinensis]
           AGZ19202.1 photosystem II protein M (chloroplast) [Oryza
           rufipogon] CDI43912.1 photosystem II protein M
           (chloroplast) [Lindenbergia philippensis] AHA12508.1
           photosystem II protein M (plastid) [Musa textilis]
           AHA12594.1 photosystem II protein M (plastid) [Ravenala
           madagascariensis] AHA12677.1 photosystem II protein M
           (plastid) [Orchidantha fimbriata] AHA12749.1 photosystem
           II protein M (plastid) [Canna indica] AHA12833.1
           photosystem II protein M (plastid) [Maranta leuconeura]
           AHA12918.1 photosystem II protein M (plastid)
           [Monocostus uniflorus] AHA13004.1 photosystem II protein
           M (plastid) [Costus pulverulentus] AHA13090.1
           photosystem II protein M (plastid) [Curcuma roscoeana]
           AHA13176.1 photosystem II protein M (plastid)
           [Thaumatococcus daniellii] AHA84923.1 photosystem II
           protein M (plastid) [Ajuga reptans] AHB14443.1
           photosystem II protein M (plastid) [Helianthus
           giganteus] AHB14528.1 photosystem II protein M (plastid)
           [Helianthus giganteus] AHB14613.1 photosystem II protein
           M (plastid) [Helianthus giganteus] AHB14698.1
           photosystem II protein M (plastid) [Helianthus
           giganteus] AHB14783.1 photosystem II protein M (plastid)
           [Helianthus grosseserratus] AHB14868.1 photosystem II
           protein M (plastid) [Helianthus grosseserratus]
           AHB14953.1 photosystem II protein M (plastid)
           [Helianthus divaricatus] AHB15038.1 photosystem II
           protein M (plastid) [Helianthus divaricatus] AHB15123.1
           photosystem II protein M (plastid) [Helianthus
           divaricatus] AHB15208.1 photosystem II protein M
           (plastid) [Helianthus divaricatus] AHB15293.1
           photosystem II protein M (plastid) [Helianthus
           decapetalus] AHB15378.1 photosystem II protein M
           (plastid) [Helianthus decapetalus] AHB15463.1
           photosystem II protein M (plastid) [Helianthus
           decapetalus] AHB15548.1 photosystem II protein M
           (plastid) [Helianthus hirsutus] AHB15633.1 photosystem
           II protein M (plastid) [Helianthus hirsutus] AHB15718.1
           photosystem II protein M (plastid) [Helianthus
           tuberosus] AHB15803.1 photosystem II protein M (plastid)
           [Helianthus tuberosus] AHB15888.1 photosystem II protein
           M (plastid) [Helianthus tuberosus] AHB15973.1
           photosystem II protein M (plastid) [Helianthus
           divaricatus] AHB16058.1 photosystem II protein M
           (plastid) [Helianthus giganteus] AHB16143.1 photosystem
           II protein M (plastid) [Helianthus giganteus] AHB16228.1
           photosystem II protein M (plastid) [Helianthus
           grosseserratus] AHB16313.1 photosystem II protein M
           (plastid) [Helianthus grosseserratus] AHB16398.1
           photosystem II protein M (plastid) [Helianthus
           grosseserratus] AHB16483.1 photosystem II protein M
           (plastid) [Helianthus grosseserratus] AHB16568.1
           photosystem II protein M (plastid) [Helianthus
           decapetalus] AHB16653.1 photosystem II protein M
           (plastid) [Helianthus decapetalus] AHB16738.1
           photosystem II protein M (plastid) [Helianthus
           decapetalus] AHB16823.1 photosystem II protein M
           (plastid) [Helianthus hirsutus] AHB16908.1 photosystem
           II protein M (plastid) [Helianthus hirsutus] AHB16993.1
           photosystem II protein M (plastid) [Helianthus
           strumosus] AHB17078.1 photosystem II protein M (plastid)
           [Helianthus tuberosus] AHB17163.1 photosystem II protein
           M (plastid) [Helianthus tuberosus] AHB17248.1
           photosystem II protein M (plastid) [Helianthus
           tuberosus] AHB17333.1 photosystem II protein M (plastid)
           [Helianthus maximiliani] AHB17418.1 photosystem II
           protein M (plastid) [Helianthus maximiliani] AHB17503.1
           photosystem II protein M (plastid) [Helianthus
           maximiliani] AHB17588.1 photosystem II protein M
           (plastid) [Helianthus maximiliani] CDJ38613.1
           photosystem II protein M (chloroplast) [Schwalbea
           americana] AHB38648.1 photosystem II protein M
           (chloroplast) [Trithuria filamentosa] AHF71634.1
           photosystem II protein M (chloroplast) [Camellia
           crapnelliana] AHF71722.1 photosystem II protein M
           (chloroplast) [Nymphaea mexicana] AHF72166.1 photosystem
           II protein M (chloroplast) [Magnolia yunnanensis]
           CCQ71614.1 photosystem II protein M (chloroplast)
           [Salvia miltiorrhiza] CDL78808.1 photosystem II protein
           M (chloroplast) [Pinguicula ehlersiae] AHH24327.1
           photosystem II protein M (chloroplast) [Japonolirion
           osense] AHH30435.1 photosystem II protein M
           (chloroplast) [Bartsia inaequalis] AHI45608.1
           photosystem II protein M (plastid) [Sabal domingensis]
           AHI87521.1 photosystem II protein M (chloroplast)
           [Chionographis japonica] AHL16901.1 photosystem II
           protein M (chloroplast) [Castanopsis echinocarpa]
           AHM02389.1 photosystem II protein M (chloroplast)
           [Praxelis clematidea] AHN07164.1 photosystem II protein
           M (plastid) [Cardamine impatiens] AHN07249.1 photosystem
           II protein M (plastid) [Cardamine resedifolia]
           AHN16119.1 photosystem II protein M (chloroplast)
           [Trigonobalanus doichangensis] AHW51952.1 photosystem II
           protein M (plastid) [Magnolia tripetala] AHW52178.1
           photosystem II protein M (chloroplast) [Rhazya stricta]
           AHY86169.1 photosystem II protein M (plastid)
           [Ampelocalamus calcareus] AHZ18125.1 photosystem II
           protein M (plastid) [Dioscorea rotundata] AHZ42965.1
           photosystem II protein M (chloroplast) [Cypripedium
           formosanum] AHZ60699.1 photosystem II protein M
           (plastid) [Oryza glaberrima] AHZ61367.1 photosystem II
           protein M (plastid) [Bergbambos tessellata] AIA24166.1
           photosystem II protein M (plastid) [Indocalamus sinicus]
           AIA24211.1 photosystem II protein M (plastid) [Oldeania
           alpina] AIA76956.1 photosystem II protein M
           (chloroplast) (chloroplast) [Capsicum annuum var.
           glabriusculum] AIB08727.1 photosystem II protein M
           (plastid) [Rhazya stricta] AIC37268.1 photosystem II
           protein M (plastid) [Cypripedium japonicum] AIE44563.1
           photosystem II protein M (chloroplast) [Oryza
           australiensis] AIG61247.1 photosystem II protein M
           (chloroplast) [Camellia grandibracteata] AIG61334.1
           photosystem II protein M (chloroplast) [Camellia
           leptophylla] AIG61421.1 photosystem II protein M
           (chloroplast) [Camellia petelotii] AIG61508.1
           photosystem II protein M (chloroplast) [Camellia
           pubicosta] AIG61595.1 photosystem II protein M
           (chloroplast) [Camellia reticulata] AIG61683.1
           photosystem II protein M (chloroplast) [Camellia
           sinensis var. dehungensis] AIG61770.1 photosystem II
           protein M (chloroplast) [Camellia sinensis var.
           pubilimba] AIG61857.1 photosystem II protein M
           (chloroplast) [Camellia sinensis var. sinensis]
           AIH00226.1 photosystem II protein M (chloroplast)
           [Bambusa multiplex] AIH00311.1 photosystem II protein M
           (chloroplast) [Phyllostachys sulphurea] AIM52856.1
           photosystem II protein M (plastid) [Bambusa bambos]
           AIM52940.1 photosystem II protein M (plastid) [Bambusa
           arnhemica] AIM53024.1 photosystem II protein M (plastid)
           [Chusquea spectabilis] AIM53108.1 photosystem II protein
           M (plastid) [Diandrolyra sp. Clark 1301] AIM53188.1
           photosystem II protein M (plastid) [Eremitis sp. Clark &
           Zhang 1343] AIM53268.1 photosystem II protein M
           (plastid) [Greslania sp. McPherson 19217] AIM53352.1
           photosystem II protein M (plastid) [Hickelia
           madagascariensis] AIM53436.1 photosystem II protein M
           (plastid) [Neohouzeaua sp. Clark & Attigala 1712]
           AIM53520.1 photosystem II protein M (plastid) [Neololeba
           atra] AIM53604.1 photosystem II protein M (plastid)
           [Olmeca reflexa] AIM53688.1 photosystem II protein M
           (plastid) [Raddia brasiliensis] AIM53856.1 photosystem
           II protein M (plastid) [Buergersiochloa bambusoides]
           AIM53939.1 photosystem II protein M (plastid) [Chusquea
           liebmannii] AIM54022.1 photosystem II protein M
           (plastid) [Lithachne pauciflora] AIM54102.1 photosystem
           II protein M (plastid) [Otatea acuminata] AIM54186.1
           photosystem II protein M (plastid) [Pariana radiciflora]
           AIM54266.1 photosystem II protein M (plastid)
           [Thamnocalamus spathiflorus] AIN81003.1 photosystem II
           protein M (chloroplast) [Zingiber officinale] AIP85225.1
           PsbM (chloroplast) [Camellia sinensis] AIQ81091.1
           photosystem II protein M (chloroplast) [Clematis
           terniflora] AIR12597.1 photosystem II protein M
           (plastid) [Bomarea edulis] AIS67526.1 photosystem II
           protein M (chloroplast) [Phragmipedium longifolium]
           AIT15986.1 photosystem II protein M (chloroplast)
           [Luzuriaga radicans] AIU44765.1 photosystem II protein M
           (chloroplast) [Phalaenopsis hybrid cultivar] AIU98530.1
           photosystem II protein M (chloroplast) [Cynara
           cardunculus var. scolymus] CDI43995.1 photosystem II
           protein M (chloroplast) [Genlisea margaretae] CDL78730.1
           photosystem II protein M (chloroplast) [Utricularia
           macrorhiza] AIW05429.1 photosystem II protein M
           (plastid) [Neobracea bahamensis] AIW05514.1 photosystem
           II protein M (plastid) [Nerium oleander] AIW05938.1
           photosystem II protein M (plastid) [Wrightia natalensis]
           AIW51833.1 photosystem II protein M (chloroplast)
           [Lasthenia burkei] AIW56411.1 photosystem II protein M
           (chloroplast) [Xerophyllum tenax] AIW56498.1 photosystem
           II protein M (chloroplast) [Heloniopsis tubiflora]
           AIX03510.1 photosystem II protein M (plastid)
           [Thalictrum coreanum] AIX89737.1 PsbM (chloroplast)
           [Fagopyrum tataricum] CED79756.1 photosystem II protein
           M (chloroplast) [Hesperelaea palmeri] AIY33816.1
           photosystem II protein M (chloroplast) [Nelumbo
           nucifera] AIY72374.1 PsbM (chloroplast) [Carthamus
           tinctorius] AIZ57527.1 photosystem II protein M
           (chloroplast) [Clematis fusca var. coreana] AJA05711.1
           photosystem II protein M (plastid) [Castanea pumila var.
           pumila] AJA38265.1 photosystem II protein M
           (chloroplast) [Diospyros glaucifolia] AJA39738.1
           photosystem II protein M (chloroplast) [Guadua
           angustifolia] AJC09129.1 PsbM (chloroplast) [Oryza
           sativa Indica Group] AJC09228.1 PsbM (chloroplast)
           [Oryza sativa Indica Group] AJC09327.1 PsbM
           (chloroplast) [Oryza sativa] AJC09427.1 PsbM
           (chloroplast) [Oryza glaberrima] AJC09527.1 PsbM
           (chloroplast) [Oryza barthii] AJC09627.1 PsbM
           (chloroplast) [Oryza rufipogon] AJC09727.1 PsbM
           (chloroplast) [Oryza meridionalis] AJC09827.1 PsbM
           (chloroplast) [Oryza glumipatula] AJC09927.1 PsbM
           (chloroplast) [Oryza punctata] AJC10101.1 PsbM
           (chloroplast) [Oryza glaberrima] AJC10201.1 PsbM
           (chloroplast) [Oryza barthii] AJC10301.1 PsbM
           (chloroplast) [Oryza barthii] AJC10401.1 PsbM
           (chloroplast) [Oryza barthii] AJC10501.1 PsbM
           (chloroplast) [Oryza barthii] AJC10601.1 PsbM
           (chloroplast) [Oryza sativa Indica Group] AJC99301.1
           PsbM (chloroplast) [Oryza sativa Japonica Group]
           AJC99390.1 PsbM (chloroplast) [Oryza sativa Japonica
           Group] AJC99731.1 PsbM (chloroplast) [Oryza glaberrima]
           AJC99831.1 PsbM (chloroplast) [Oryza nivara] AJC99931.1
           PsbM (chloroplast) [Oryza barthii] AJD00032.1 PsbM
           (chloroplast) [Oryza longistaminata] BAQ19635.1
           photosystem II protein M (chloroplast) [Ananas comosus]
           AJD76815.1 photosystem II protein M (chloroplast)
           [Lathraea squamaria] AJE28368.1 photosystem II protein M
           (chloroplast) [Premna microphylla] AJE71211.1
           photosystem II protein M (plastid) [Acorus gramineus]
           AJE73083.1 photosystem II protein M (plastid) [Xanthisma
           spinulosum] AJE73159.1 photosystem II protein M
           (plastid) [Gutierrezia sarothrae] AJE73235.1 photosystem
           II protein M (plastid) [Liatris squarrosa] AJE73387.1
           photosystem II protein M (plastid) [Erigeron strigosus]
           AJE73539.1 photosystem II protein M (plastid) [Cirsium
           undulatum] AJE73615.1 photosystem II protein M (plastid)
           [Solidago canadensis var. scabra] AJE73691.1 photosystem
           II protein M (plastid) [Erigeron philadelphicus]
           AJE73767.1 photosystem II protein M (plastid)
           [Heterotheca stenophylla] AJE73919.1 photosystem II
           protein M (plastid) [Vernonia baldwinii] AJE73995.1
           photosystem II protein M (plastid) [Helenium flexuosum]
           AJE74071.1 photosystem II protein M (plastid)
           [Heterotheca villosa] AJE74147.1 photosystem II protein
           M (plastid) [Cirsium altissimum] AJE74223.1 photosystem
           II protein M (plastid) [Echinacea angustifolia]
           AJE74299.1 photosystem II protein M (plastid)
           [Helianthus petiolaris] AJE74603.1 photosystem II
           protein M (plastid) [Ratibida columnifera] AJE74679.1
           photosystem II protein M (plastid) [Lygodesmia juncea]
           AJE74755.1 photosystem II protein M (plastid)
           [Hymenopappus tenuifolius] AJE74831.1 photosystem II
           protein M (plastid) [Cirsium canescens] AJE74907.1
           photosystem II protein M (plastid) [Solidago gigantea]
           AJE75059.1 photosystem II protein M (plastid) [Erigeron
           bellidiastrum] AJE75135.1 photosystem II protein M
           (plastid) [Tragopogon dubius] AJF94036.1 photosystem II
           protein M (chloroplast) [Diospyros sp. LHM-2015]
           AJF94123.1 photosystem II protein M (chloroplast)
           [Diospyros lotus] AJF94210.1 photosystem II protein M
           (chloroplast) [Diospyros oleifera] AJK90741.1
           photosystem II protein M (chloroplast) [Capsicum
           lycianthoides] AJL34403.1 photosystem II protein M
           (chloroplast) [Dunalia obovata] AJM70051.1 photosystem
           II protein M (chloroplast) [Chloranthus japonicus]
           AJM70094.1 photosystem II protein M (chloroplast)
           [Iochroma nitidum] AJN90300.1 photosystem II protein M
           (plastid) [Physalis peruviana] AJN90406.1 photosystem II
           protein M (chloroplast) [Phyllostachys edulis]
           AJN90500.1 photosystem II protein M (chloroplast)
           [Iochroma stenanthum] AJN91009.1 photosystem II protein
           M (plastid) [Lithocarpus balansae] AJO25106.1
           photosystem II protein M (chloroplast) [Solanum
           lycopersicum] AJO25283.1 PSII M protein (chloroplast)
           [Diplopanax stachyanthus] AJO26081.1 photosystem II
           protein M (chloroplast) [Actinidia chinensis] AJO26164.1
           photosystem II protein M (chloroplast) [Actinidia
           chinensis] AJO26247.1 photosystem II protein M
           (chloroplast) [Actinidia deliciosa] AJO26330.1
           photosystem II protein M (chloroplast) [Actinidia
           chinensis] AJO61575.1 photosystem II protein M
           (chloroplast) [Saracha punctata] AJP09557.1 photosystem
           II protein M (chloroplast) [Ipomoea batatas] AJP33663.1
           photosystem II protein M (chloroplast) [Oryza barthii]
           AJP33745.1 photosystem II protein M (chloroplast) [Oryza
           barthii] AJP33827.1 photosystem II protein M
           (chloroplast) [Oryza barthii] AJP33909.1 photosystem II
           protein M (chloroplast) [Oryza barthii] AJP33992.1
           photosystem II protein M (chloroplast) [Oryza
           glaberrima] AJP34073.1 photosystem II protein M
           (chloroplast) [Oryza glaberrima] AJP34156.1 photosystem
           II protein M (chloroplast) [Oryza glumipatula]
           AJP34239.1 photosystem II protein M (chloroplast) [Oryza
           longistaminata] AJP34322.1 photosystem II protein M
           (chloroplast) [Oryza longistaminata] AJP34405.1
           photosystem II protein M (chloroplast) [Oryza
           officinalis] AJR30373.1 photosystem II protein M
           (chloroplast) [Vassobia breviflora] AJR32894.1
           photosystem II protein M (chloroplast) [Dunalia spinosa]
           AJS14248.1 photosystem II protein M (chloroplast)
           [Iochroma loxense] AJS14332.1 photosystem II protein M
           (chloroplast) [Iochroma calycinum] AJS14413.1
           photosystem II protein M (plastid) [Ruellia breedlovei]
           AJS14499.1 photosystem II protein M (plastid) [Iochroma
           australe] AJV88590.1 photosystem II protein M
           (chloroplast) [Carludovica palmata] AJV89101.1
           photosystem II protein M (plastid) [Avena sativa]
           AJV89267.1 photosystem II protein M (plastid)
           [Brachyelytrum aristosum] AJV89604.1 photosystem II
           protein M (plastid) [Diarrhena obovata] AJV89853.1
           photosystem II protein M (plastid) [Melica mutica]
           AJV89936.1 photosystem II protein M (plastid) [Melica
           subulata] AJV90103.1 photosystem II protein M (plastid)
           [Phaenosperma globosum] AJV90186.1 photosystem II
           protein M (plastid) [Phalaris arundinacea] AJW60142.1
           photosystem II protein M (chloroplast) [Quercus aliena]
           AJW75044.1 photosystem II protein M (chloroplast)
           [Vassobia dichotoma] AJY78686.1 photosystem II protein M
           (chloroplast) [Solanum cheesmaniae] AJY78769.1
           photosystem II protein M (chloroplast) [Solanum
           chilense] AJY78852.1 photosystem II protein M
           (chloroplast) [Solanum galapagense] AJY78935.1
           photosystem II protein M (chloroplast) [Solanum
           habrochaites] AJY79018.1 photosystem II protein M
           (chloroplast) [Solanum lycopersicum] AJY79101.1
           photosystem II protein M (chloroplast) [Solanum
           neorickii] AJY79184.1 photosystem II protein M
           (chloroplast) [Solanum peruvianum] AJY79267.1
           photosystem II protein M (chloroplast) [Solanum
           pimpinellifolium] AKA66526.1 photosystem II protein M
           (chloroplast) [Dunalia brachyacantha] AKA66957.1
           photosystem II protein M (chloroplast) [Quercus spinosa]
           AKB92921.1 photosystem II protein M (chloroplast)
           [Colchicum autumnale] AKB93007.1 photosystem II protein
           M (chloroplast) [Gloriosa superba] AKC05463.1
           photosystem II protein M (chloroplast) [Quercus
           aquifolioides] AKE07330.1 photosystem II protein M
           (plastid) [Guadua weberbaueri] AKF00569.1 photosystem II
           protein M (chloroplast) [Reinhardtia paiewonskiana]
           AKF00832.1 photosystem II protein M (chloroplast)
           [Veitchia spiralis] AKF00918.1 photosystem II protein M
           (chloroplast) [Areca vestiaria] AKF01984.1 photosystem
           II protein M (chloroplast) [Manicaria saccifera]
           AKF33684.1 photosystem II protein M (chloroplast)
           [Dioscorea zingiberensis] AKF78406.1 photosystem II
           protein M (chloroplast) [Dunalia solanacea] AKG49782.1
           photosystem II protein M (chloroplast) [Cynara humilis]
           AKH02193.1 photosystem II protein M (chloroplast)
           [Cynara cardunculus var. scolymus] AKH02313.1
           photosystem II protein M (chloroplast) [Iochroma
           tingoanum] AKH04419.1 photosystem II protein M (plastid)
           [Chusquea circinata] AKH04503.1 photosystem II protein M
           (plastid) [Chusquea sp. PFM-2015] AKH04587.1 photosystem
           II protein M (plastid) [Otatea glauca] AKH04671.1
           photosystem II protein M (plastid) [Pariana campestris]
           AKH04754.1 photosystem II protein M (plastid) [Pariana
           radiciflora] AKH04837.1 photosystem II protein M
           (plastid) [Pariana sp. PFM-2015] AKH49622.1 photosystem
           II protein M (chloroplast) [Chikusichloa aquatica]
           AKJ25292.1 photosystem II protein M (plastid) [Carex
           siderosticta] AKJ76797.1 PSII M protein (chloroplast)
           [Rosmarinus officinalis] AKJ77211.1 photosystem II M
           protein (chloroplast) [Scutellaria baicalensis]
           AKJ77478.1 photosystem II protein M (chloroplast)
           [Carthamus tinctorius] AKJ77557.1 photosystem II protein
           M (chloroplast) [Dioscorea nipponica] AKJ77638.1
           photosystem II protein M (chloroplast) [Fagopyrum
           cymosum] AKJ77735.1 photosystem II protein M
           (chloroplast) [Perilla frutescens] AKJ83505.1
           photosystem II protein M (chloroplast) [Dieffenbachia
           seguine] AKJ83761.1 photosystem II protein M
           (chloroplast) [Pinellia ternata] AKJ85808.1 photosystem
           II protein M (chloroplast) [Podococcus barteri]
           AKM21331.1 PSII M protein (chloroplast) [Pogostemon
           yatabeanus] AKM21418.1 PSII M protein (chloroplast)
           [Pogostemon stellatus] AKM21506.1 PSII M protein
           (chloroplast) [Paulownia coreana] AKM21593.1 PSII M
           protein (chloroplast) [Paulownia tomentosa] AKM21853.1
           PsbM (chloroplast) [Solanum commersonii] AKM21939.1 PsbM
           (chloroplast) [Solanum nigrum] AKM22025.1 PsbM
           (chloroplast) [Solanum tuberosum] AKM98154.1 photosystem
           II M protein (chloroplast) [Anemone patens] AKM98242.1
           photosystem II M protein (chloroplast) [Anemone patens]
           AKM98330.1 photosystem II M protein (chloroplast)
           [Pulsatilla pratensis] AKM98418.1 photosystem II M
           protein (chloroplast) [Pulsatilla pratensis] AKM98506.1
           photosystem II M protein (chloroplast) [Pulsatilla
           vernalis] AKM98594.1 photosystem II M protein
           (chloroplast) [Pulsatilla vernalis] AKQ49257.1
           photosystem II protein M (chloroplast) [Cynara
           cardunculus var. altilis] AKQ49344.1 photosystem II
           protein M (chloroplast) [Cynara cardunculus var.
           altilis] AKQ49431.1 photosystem II protein M
           (chloroplast) [Cynara baetica] AKQ49518.1 photosystem II
           protein M (chloroplast) [Cynara cornigera] AKQ49605.1
           photosystem II protein M (chloroplast) [Cynara
           cardunculus var. scolymus] AKQ49692.1 photosystem II
           protein M (chloroplast) [Cynara cardunculus var.
           scolymus] AKQ49779.1 photosystem II protein M
           (chloroplast) [Cynara cardunculus var. scolymus]
           AKQ49866.1 photosystem II protein M (chloroplast)
           [Cynara cardunculus var. scolymus] AKQ49953.1
           photosystem II protein M (chloroplast) [Cynara
           cardunculus var. scolymus] AKQ50040.1 photosystem II
           protein M (chloroplast) [Cynara cardunculus var.
           scolymus] AKQ50127.1 photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           AKQ50214.1 photosystem II protein M (chloroplast)
           [Cynara cardunculus var. sylvestris] AKQ50301.1
           photosystem II protein M (chloroplast) [Cynara
           cardunculus var. sylvestris] AKQ50388.1 photosystem II
           protein M (chloroplast) [Cynara cardunculus var.
           sylvestris] AKQ50475.1 photosystem II protein M
           (chloroplast) [Cynara cardunculus var. sylvestris]
           AKQ50562.1 photosystem II protein M (chloroplast)
           [Cynara cardunculus var. sylvestris] AKQ50649.1
           photosystem II protein M (chloroplast) [Cynara
           cardunculus var. sylvestris] AKQ50736.1 photosystem II
           protein M (chloroplast) [Cynara cardunculus var.
           sylvestris] AKQ50823.1 photosystem II protein M
           (chloroplast) [Cynara syriaca] AKQ51153.1 photosystem II
           protein M (plastid) [Borassus flabellifer] AKR06841.1
           photosystem II protein M (chloroplast) [Carnegiea
           gigantea] AKR80586.1 photosystem II protein M (plastid)
           [Sararanga sinuosa] AKR80709.1 photosystem II protein M
           (plastid) [Croomia japonica] AKR80809.1 photosystem II
           protein M (plastid) [Xerophyta retinervis] AKR80991.1
           photosystem II protein M (plastid) [Stichoneuron
           caudatum] AKR81062.1 photosystem II protein M (plastid)
           [Pentastemona sumatrana] AKR81185.1 photosystem II
           protein M (plastid) [Freycinetia banksii] AKR81222.1
           photosystem II protein M (plastid) [Cyclanthus
           bipartitus] AKS28765.1 photosystem II protein M
           (chloroplast) [Capsella rubella] AKT93688.1 photosystem
           II protein M (chloroplast) [Rheum palmatum] AKU47126.1
           photosystem II protein M (chloroplast) [Ananas comosus]
           AKU47244.1 photosystem II protein M (chloroplast)
           [Capsella grandiflora] AKZ23246.1 photosystem II protein
           M (plastid) [Carduus nutans] AKZ23247.1 photosystem II
           protein M (plastid) [Vernonia baldwinii] AKZ23248.1
           photosystem II protein M (plastid) [Helianthus
           pauciflorus subsp. subrhomboideus] AKZ23249.1
           photosystem II protein M (plastid) [Helianthus
           tuberosus] AKZ23250.1 photosystem II protein M (plastid)
           [Rudbeckia hirta var. pulcherrima] AKZ23251.1
           photosystem II protein M (plastid) [Silphium
           integrifolium] AKZ23252.1 photosystem II protein M
           (plastid) [Heliopsis helianthoides var. occidentalis]
           AKZ23253.1 photosystem II protein M (plastid) [Grindelia
           squarrosa var. squarrosa] AKZ23254.1 photosystem II
           protein M (plastid) [Solidago missouriensis] AKZ23258.1
           photosystem II protein M (plastid) [Symphoricarpos
           occidentalis] AKZ23260.1 photosystem II protein M
           (plastid) [Physalis heterophylla] AKZ23261.1 photosystem
           II protein M (plastid) [Physalis virginiana] AKZ23262.1
           photosystem II protein M (plastid) [Solanum carolinense]
           AKZ23263.1 photosystem II protein M (plastid) [Solanum
           rostratum] AKZ23264.1 photosystem II protein M (plastid)
           [Solanum triflorum] AKZ23265.1 photosystem II protein M
           (plastid) [Monarda fistulosa var. mollis] AKZ23266.1
           photosystem II protein M (plastid) [Salvia nemorosa]
           AKZ23267.1 photosystem II protein M (plastid) [Nepeta
           cataria] AKZ23272.1 photosystem II protein M (plastid)
           [Verbena hastata] AKZ23273.1 photosystem II protein M
           (plastid) [Veronica americana] AKZ23275.1 photosystem II
           protein M (plastid) [Convolvulus arvensis] AKZ23276.1
           photosystem II protein M (plastid) [Ipomoea leptophylla]
           AKZ23277.1 photosystem II protein M (plastid) [Evolvulus
           nuttallianus] AKZ23281.1 photosystem II protein M
           (plastid) [Silene antirrhina] AKZ23282.1 photosystem II
           protein M (plastid) [Silene vulgaris] AKZ30106.1
           photosystem II protein M (chloroplast) [Selliera
           radicans] AKZ30165.1 photosystem II protein M
           (chloroplast) [Velleia rosea] AKZ30231.1 photosystem II
           protein M (chloroplast) [Goodenia helmsii] AKZ30363.1
           photosystem II protein M (chloroplast) [Goodenia
           hassallii] AKZ30429.1 photosystem II protein M
           (chloroplast) [Goodenia pinifolia] AKZ30496.1
           photosystem II protein M (chloroplast) [Goodenia
           viscida] AKZ30562.1 photosystem II protein M
           (chloroplast) [Velleia discophora] AKZ30628.1
           photosystem II protein M (chloroplast) [Goodenia
           drummondii] AKZ30694.1 photosystem II protein M
           (chloroplast) [Velleia foliosa] AKZ30827.1 photosystem
           II protein M (chloroplast) [Goodenia tripartita]
           AKZ30955.1 photosystem II protein M (chloroplast)
           [Goodenia filiformis] AKZ31089.1 photosystem II protein
           M (chloroplast) [Goodenia decursiva] AKZ31156.1
           photosystem II protein M (chloroplast) [Scaevola
           collaris] AKZ31214.1 photosystem II protein M
           (chloroplast) [Goodenia micrantha] AKZ31350.1
           photosystem II protein M (chloroplast) [Coopernookia
           polygalacea] AKZ31416.1 photosystem II protein M
           (chloroplast) [Coopernookia strophiolata] AKZ31480.1
           photosystem II protein M (chloroplast) [Verreauxia
           reinwardtii] AKZ31546.1 photosystem II protein M
           (chloroplast) [Goodenia phillipsiae] ALB38577.1
           photosystem II protein M (chloroplast) [Epipremnum
           aureum] ALB78253.1 photosystem II protein M
           (chloroplast) [Tanaecium tetragonolobum] ALD50097.1 PsbM
           (chloroplast) [Capsicum annuum var. glabriusculum]
           ALD50183.1 PsbM (chloroplast) [Capsicum frutescens]
           ALD50269.1 PsbM (chloroplast) [Capsicum annuum var.
           annuum] ALD50355.1 PsbM (chloroplast) [Capsicum baccatum
           var. baccatum] ALE28961.1 photosystem II protein M
           (plastid) [Colpothrinax cookii] ALF35924.1 photosystem
           II protein M (chloroplast) [Oryza sativa aromatic
           subgroup] ALF36001.1 photosystem II protein M
           (chloroplast) [Oryza sativa tropical japonica subgroup]
           ALF99697.1 photosystem II protein M (chloroplast)
           [Colobanthus quitensis] ALI31134.1 photosystem II
           protein M (chloroplast) [Solanum nigrum] ALI91923.1 PsbM
           (chloroplast) [Apodytes dimidiata] ALI91925.1 PsbM
           (chloroplast) [Cassinopsis madagascariensis] ALI91926.1
           PsbM (chloroplast) [Cordia sebestena] ALI91928.1 PsbM
           (chloroplast) [Discophora guianensis] ALI91929.1 PsbM
           (chloroplast) [Emmotum nitens] ALI91930.1 PsbM
           (chloroplast) [Garrya flavescens] ALI91932.1 PsbM
           (chloroplast) [Hydrolea corymbosa] ALI91943.1 PsbM
           (chloroplast) [Oncotheca balansae] ALI91945.1 PsbM
           (chloroplast) [Platea latifolia] ALI91946.1 PsbM
           (chloroplast) [Polypremum procumbens] ALI91955.1 PsbM
           (chloroplast) [Sphenoclea zeylanica] ALI91957.1 PsbM
           (chloroplast) [Vahlia capensis] ALJ49590.1 photosystem
           II protein M (chloroplast) [Pseudosasa japonica]
           ALJ49667.1 photosystem II protein M (chloroplast)
           [Pseudosasa japonica] ALJ78244.1 photosystem II protein
           M (plastid) [Plantago maritima] ALJ78340.1 photosystem
           II protein M (plastid) [Plantago media] ALK00672.1 PsbM
           (chloroplast) [Oryza glumipatula] ALK00777.1 PsbM
           (chloroplast) [Oryza glumipatula] ALK26610.1 photosystem
           II protein M (chloroplast) [Ostrya rehderiana]
           ALL53067.1 photosystem II protein M (chloroplast)
           [Bletilla striata] ALL97035.1 photosystem II protein M
           (chloroplast) [Musa balbisiana] ALN11567.1 photosystem
           II protein M (chloroplast) [Iochroma edule] ALN11597.1
           photosystem II protein M (chloroplast) [Scutellaria
           insignis] ALN98165.1 photosystem II protein M
           (chloroplast) [Dendrobium chrysotoxum] ALP83540.1
           photosystem II protein M (chloroplast) [Curcuma
           flaviflora] ALS20006.1 photosystem II protein M
           (chloroplast) [Metanarthecium luteoviride] ALT06370.1
           photosystem II protein M (chloroplast) [Guadua
           chacoensis] ALT06454.1 photosystem II protein M
           (chloroplast) [Merostachys sp. Greco 18] ALT14466.1
           photosystem II protein M (chloroplast) [Nicotiana
           otophora] ALT55444.1 photosystem II protein M
           (chloroplast) [Syagrus coronata] ALV25562.1 photosystem
           II protein M (chloroplast) [Aletris spicata] ALV25646.1
           photosystem II protein M (chloroplast) [Aletris fauriei]
           CUA65568.1 photosystem II protein M (chloroplast)
           [Capsella rubella] CUA65652.1 photosystem II protein M
           (chloroplast) [Camelina sativa] ALV90222.1 photosystem
           II protein M (chloroplast) [Silene latifolia subsp.
           alba] ALV90303.1 photosystem II protein M (chloroplast)
           [Silene latifolia subsp. alba] ALZ50011.1 PSII M protein
           (chloroplast) [Abeliophyllum distichum] ALZ50098.1 PSII
           low MW protein M (chloroplast) [Coreanomecon
           hylomeconoides] AMB20966.1 photosystem II protein M
           (chloroplast) [Oryza minuta] AMC31872.1 photosystem II
           protein M (chloroplast) [Capsella bursa-pastoris]
           AMC31883.1 photosystem II protein M (chloroplast)
           [Lepidium densiflorum] AMC31887.1 photosystem II protein
           M (chloroplast) [Oxalis dillenii] AMC31889.1 photosystem
           II protein M (chloroplast) [Physaria ludoviciana]
           AMD07888.1 photosystem II protein M (chloroplast)
           [Diospyros kaki] AMD08098.1 photosystem II protein M
           (chloroplast) [Akebia trifoliata] AMD08267.1 photosystem
           II protein M (chloroplast) [Euptelea pleiosperma]
           AMD08352.1 photosystem II protein M (chloroplast)
           [Meliosma aff. cuneifolia Moore 333] AMD08521.1
           photosystem II protein M (chloroplast) [Stephania
           japonica] AMD08606.1 photosystem II protein M
           (chloroplast) [Pachysandra terminalis] AMH85868.1
           photosystem II protein M (chloroplast) [Quercus baronii]
           AMK97312.1 psbM (chloroplast) [Drosera rotundifolia]
           AML26895.1 photosystem II protein M (chloroplast)
           [Monsonia emarginata] AMM05537.1 photosystem II protein
           M (plastid) [Nicotiana tabacum] AMN14339.1 photosystem
           II protein M (chloroplast) [Utricularia reniformis]
           AMP19570.1 photosystem II protein M (chloroplast)
           [Iochroma cardenasianum] AMQ13314.1 photosystem II
           protein M (plastid) [Tofieldia thibetica] AMQ13399.1
           photosystem II protein M (plastid) [Potamogeton
           perfoliatus] AMQ13484.1 photosystem II protein M
           (plastid) [Sagittaria lichuanensis] AMQ32854.1
           photosystem II protein M (chloroplast) [Stenogyne
           haliakalae] AMQ32942.1 photosystem II protein M
           (chloroplast) [Phyllostegia waimeae] AMQ33030.1
           photosystem II protein M (chloroplast) [Stenogyne
           bifida] AMQ33118.1 photosystem II protein M
           (chloroplast) [Haplostachys haplostachya] AMQ33206.1
           photosystem II protein M (chloroplast) [Phyllostegia
           velutina] AMQ33382.1 photosystem II protein M
           (chloroplast) [Stenogyne kanehoana] AMQ33470.1
           photosystem II protein M (chloroplast) [Haplostachys
           linearifolia] AMQ33558.1 photosystem II protein M
           (chloroplast) [Stachys chamissonis] AMQ33646.1
           photosystem II protein M (chloroplast) [Stachys
           coccinea] AMQ33734.1 photosystem II protein M
           (chloroplast) [Stachys sylvatica] AMQ33822.1 photosystem
           II protein M (chloroplast) [Stachys byzantina]
           AMQ33923.1 photosystem II protein M (chloroplast)
           [Helianthus petiolaris subsp. fallax] AMQ99368.1
           photosystem II M protein (chloroplast) [Aconitum
           chiisanense] AMR00384.1 photosystem II protein M
           (chloroplast) [Iochroma australe] AMR73816.1 photosystem
           II M protein (chloroplast) [Kolkwitzia amabilis]
           AMR74102.1 PsbM (chloroplast) [Perilla frutescens]
           AMR74190.1 PsbM (chloroplast) [Perilla frutescens var.
           acuta] AMR74278.1 PsbM (chloroplast) [Perilla frutescens
           f. crispidiscolor] AMR74366.1 PsbM (chloroplast)
           [Perilla frutescens var. crispa] AMR74454.1 PsbM
           (chloroplast) [Perilla frutescens var. crispa]
           AMR74542.1 PsbM (chloroplast) [Perilla frutescens var.
           frutescens] AMR74630.1 PsbM (chloroplast) [Perilla
           citriodora] AMR74718.1 PsbM (chloroplast) [Perilla
           frutescens var. hirtella] AMR74806.1 PsbM (chloroplast)
           [Perilla setoyensis] AMV74052.1 photosystem II protein M
           (plastid) [Iochroma lehmannii] AMW65026.1 photosystem II
           protein M (chloroplast) [Mauritia flexuosa] AMW65112.1
           photosystem II protein M (plastid) [Caryota mitis]
           AMW65198.1 photosystem II protein M (plastid) [Wallichia
           densiflora] AMW65283.1 photosystem II protein M
           (plastid) [Veitchia arecina] AMW65369.1 photosystem II
           protein M (plastid) [Trithrinax brasiliensis] AMW65456.1
           photosystem II protein M (plastid) [Tahina spectabilis]
           AMW65535.1 photosystem II protein M (plastid) [Serenoa
           repens] AMW65707.1 photosystem II protein M (plastid)
           [Pritchardia thurstonii] AMW65793.1 photosystem II
           protein M (plastid) [Pigafetta elata] AMW65880.1
           photosystem II protein M (plastid) [Phytelephas
           aequatorialis] AMW65966.1 photosystem II protein M
           (plastid) [Nypa fruticans] AMW66052.1 photosystem II
           protein M (plastid) [Metroxylon warburgii] AMW66138.1
           photosystem II protein M (plastid) [Lodoicea maldivica]
           AMW66224.1 photosystem II protein M (plastid) [Licuala
           paludosa] AMW66310.1 photosystem II protein M (plastid)
           [Leucothrinax morrisii] AMW66396.1 photosystem II
           protein M (plastid) [Hanguana malayana] AMW66482.1
           photosystem II protein M (plastid) [Eugeissona tristis]
           AMW66564.1 photosystem II protein M (plastid)
           [Eremospatha macrocarpa] AMW66650.1 photosystem II
           protein M (plastid) [Corypha lecomtei] AMW66736.1
           photosystem II protein M (plastid) [Chuniophoenix nana]
           AMW66822.1 photosystem II protein M (plastid)
           [Chamaerops humilis] AMW66908.1 photosystem II protein M
           (plastid) [Brahea brandegeei] AMW66994.1 photosystem II
           protein M (plastid) [Borassodendron machadonis]
           AMW67080.1 photosystem II protein M (plastid) [Baxteria
           australis] AMW67166.1 photosystem II protein M (plastid)
           [Arenga caudata] AMW67252.1 photosystem II protein M
           (plastid) [Areca vestiaria] AMW67331.1 photosystem II
           protein M (plastid) [Acoelorraphe wrightii] AMW67417.1
           photosystem II protein M (plastid) [Washingtonia
           robusta] AMX21457.1 photosystem II protein M
           (chloroplast) [Helianthus praecox] AMX21591.1
           photosystem II protein M (chloroplast) [Iochroma
           grandiflorum] AMX21682.1 photosystem II protein M
           (chloroplast) [Iochroma parvifolium] AMX22330.1
           photosystem II protein M (chloroplast) [Helianthus
           petiolaris] AMX23152.1 photosystem II protein M
           (chloroplast) [Solanum melongena] AMX23231.1 photosystem
           II protein M (plastid) [Ananas comosus] AMY95752.1
           photosystem II protein M (chloroplast) [Iochroma
           umbellatum] AMY95987.1 photosystem II protein M
           (plastid) [Geranium incanum] ANA07551.1 photosystem II
           protein M (chloroplast) [Acnistus arborescens x Iochroma
           cyaneum] ANA10808.1 photosystem II protein M
           (chloroplast) [Cabomba caroliniana] ANA56572.1
           photosystem II protein M (plastid) [Annona cherimola]
           ANA56680.1 photosystem II protein M (chloroplast)
           [Iochroma lehmannii] ANA56795.1 photosystem II protein M
           (chloroplast) [Iochroma salpoanum] ANA57528.1
           photosystem II protein M (plastid) [Veronica nakaiana]
           ANA57616.1 photosystem II protein M (plastid) [Veronica
           persica] ANA57702.1 photosystem II protein M (plastid)
           [Veronicastrum sibiricum] ANA91059.1 photosystem II
           protein M (chloroplast) [Eriolarynx fasciculata]
           ANA91194.1 photosystem II protein M (chloroplast)
           [Helianthus debilis] ANB44477.1 photosystem II protein M
           (chloroplast) [Iochroma ellipticum] ANB44561.1
           photosystem II protein M (chloroplast) [Iochroma
           cyaneum] ANB78716.1 photosystem II protein M
           (chloroplast) [Bruinsmia polysperma] ANB78980.1
           photosystem II protein M (chloroplast) [Helianthus
           annuus subsp. texanus] ANC49166.1 photosystem II protein
           M (chloroplast) [Acnistus arborescens] ANC62757.1 PsbM
           (plastid) [Solanum melongena] ANC62909.1 photosystem II
           protein M (chloroplast) [Erythranthe lutea] ANC95050.1
           photosystem II protein M (chloroplast) [Dunalia
           spathulata] ANC95229.1 photosystem II protein M
           (plastid) [Iochroma gesnerioides] ANC95361.1 photosystem
           II protein M (chloroplast) [Iochroma cyaneum] ANC96372.1
           photosystem II protein M (chloroplast) [Iochroma
           albianthum] AND96964.1 PSII M protein (chloroplast)
           [Cornus controversa] ANE11136.1 photosystem II protein M
           (plastid) [Ananas comosus] ANE20275.1 photosystem II
           protein M (plastid) [Iochroma confertiflorum] ANF03653.1
           photosystem II protein M (chloroplast) [Helianthus
           argophyllus] ANF03885.1 photosystem II protein M
           (plastid) [Helianthus annuus] ANF05207.1 photosystem II
           protein M (chloroplast) [Scopolia parviflora] ANG44664.1
           photosystem II protein M (chloroplast) [Oryza sativa
           Indica Group] CZF94795.1 PSII low MW protein
           (chloroplast) [Arabidopsis suecica] CZF94880.1 PSII low
           MW protein (chloroplast) [Arabidopsis suecica]
           CZF94965.1 PSII low MW protein (chloroplast)
           [Arabidopsis suecica] ANJ03951.1 PsbM (chloroplast)
           [Capsicum chinense] ANJ04267.1 photosystem II protein M
           (plastid) [Castilleja paramensis] ANJ04384.1 photosystem
           II M protein (chloroplast) [Aconitum kusnezoffii]
           ANJ04467.1 photosystem II M protein (chloroplast)
           [Gymnaconitum gymnandrum] ANJ04550.1 photosystem II M
           protein (chloroplast) [Aconitum barbatum var. puberulum]
           ANJ59888.1 photosystem II protein M (chloroplast)
           [Nymphaea jamesoniana] ANJ78498.1 photosystem II protein
           M (chloroplast) [Oryza brachyantha] ANN44724.1
           photosystem II protein M (chloroplast) [Liriodendron
           chinense] ANO44529.1 photosystem II protein M
           (chloroplast) [Alstroemeria longistaminea] ANO44652.1
           photosystem II protein M (chloroplast) [Bomarea sp. 878]
           ANO44835.1 photosystem II protein M (chloroplast)
           [Philesia magellanica] ANO44957.1 photosystem II protein
           M (chloroplast) [Uvularia grandiflora] ANO45016.1
           photosystem II protein M (chloroplast) [Uvularia
           sessiliflora] ANO45075.1 photosystem II protein M
           (chloroplast) [Wurmbea pygmaea] ANO45243.1 photosystem
           II protein M (chloroplast) [Lapageria rosea] ANO45482.1
           photosystem II protein M (chloroplast) [Burchardia
           umbellata] ANO45542.1 photosystem II protein M
           (chloroplast) [Ripogonum album] ANO45603.1 photosystem
           II protein M (chloroplast) [Prosartes lanuginosa]
           ANO45664.1 photosystem II protein M (chloroplast)
           [Petermannia cirrosa] ANP25490.1 PSII M protein
           (chloroplast) [Eucommia ulmoides] ANP25595.1 photosystem
           II protein M (chloroplast) [Schisandra chinensis]
           ANP25679.1 photosystem II protein M (chloroplast)
           [Quercus edithiae] ANQ38731.1 photosystem II protein M
           (plastid) [Bergbambos tessellata] ANQ38813.1 photosystem
           II protein M (plastid) [Fargesia nitida] ANQ39007.1
           photosystem II protein M (plastid) [Oldeania alpina]
           ANQ39091.1 photosystem II protein M (plastid)
           [Phyllostachys aurea] ANQ39219.1 photosystem II protein
           M (plastid) [Sasa veitchii] ANQ46319.1 psbM
           (chloroplast) [Pogostemon cablin] ANS11078.1 photosystem
           II protein M (plastid) [Chimonocalamus sp. Clark &
           Reiners s.n.] ANS11161.1 photosystem II protein M
           (plastid) [Shibataea kumasaca] ANS80720.1 photosystem II
           protein M (chloroplast) [Ilex latifolia] ANS80815.1
           photosystem II protein M (chloroplast) [Ilex
           szechwanensis] ANS80910.1 photosystem II protein M
           (chloroplast) [Ilex pubescens] ANS81005.1 photosystem II
           protein M (chloroplast) [Ilex polyneura] ANS81100.1
           photosystem II protein M (chloroplast) [Ilex sp.
           XY-2016] ANS81195.1 photosystem II protein M
           (chloroplast) [Ilex delavayi] ANS81290.1 photosystem II
           protein M (chloroplast) [Ilex wilsonii] ANT72464.1
           photosystem II protein M (chloroplast) [Cephalanthera
           longifolia] ANT72552.1 photosystem II protein M
           (chloroplast) [Epipactis mairei] ANT72747.1 photosystem
           II protein M (chloroplast) [Epipactis veratrifolia]
           ANT72863.1 photosystem II protein M (chloroplast)
           [Neottia pinetorum] ANT72948.1 photosystem II protein M
           (chloroplast) [Listera fugongensis] ANT73034.1
           photosystem II protein M (chloroplast) [Neottia ovata]
           ANU80148.1 PSII low MW protein M (chloroplast) [Averrhoa
           carambola] ANU80297.1 photosystem II M protein
           (chloroplast) [Aconitum carmichaelii] ANV27748.1 PsbM
           (chloroplast) [Aconitum coreanum] ANW06554.1 photosystem
           II protein M (chloroplast) [Ampelocalamus naibunensis]
           ANW36487.1 photosystem II protein M (chloroplast)
           [Quercus aliena] ANW36573.1 photosystem II protein M
           (chloroplast) [Quercus aliena var. acutiserrata]
           ANW36659.1 photosystem II protein M (chloroplast)
           [Quercus variabilis] ANW36745.1 photosystem II protein M
           (chloroplast) [Quercus dolicholepis] ANW36902.1
           photosystem II protein M (chloroplast) [Amaranthus
           hypochondriacus] ANW47784.1 photosystem II protein M
           (chloroplast) [Arabidopsis thaliana] ANW47949.1 PsbM
           (chloroplast) [Eclipta prostrata] ANX10378.1 photosystem
           II protein M (plastid) [Kuruna densifolia] ANY60334.1
           photosystem II protein M (chloroplast) [Averrhoa
           carambola] ANZ53268.1 PSII low MW protein M
           (chloroplast) [Carissa macrocarpa] BAV56628.1
           photosystem II protein M (chloroplast) [Ipomoea nil]
           AON77181.1 photosystem II protein M (chloroplast)
           [Actinidia polygama] AON77264.1 photosystem II protein M
           (chloroplast) [Actinidia tetramera] AON77281.1
           photosystem II protein M (chloroplast) [Clematoclethra
           scandens subsp. hemsleyi] AOP19380.1 photosystem II
           protein M (chloroplast) [Helwingia himalaica] AOQ76916.1
           photosystem II protein M (chloroplast) [Davidia
           involucrata] AOR40733.1 photosystem II protein M
           (chloroplast) [Streptochaeta spicata] AOR40816.1
           photosystem II protein M (chloroplast) [Leptaspis
           banksii] AOR40891.1 photosystem II protein M
           (chloroplast) [Leptaspis zeylanica] AOS52953.1
           photosystem II M protein (chloroplast) [Aconitum
           austrokoreense] AOS85817.1 photosystem II proteinM
           (chloroplast) [Aconitum barbatum var. hispidum]
           AOS85902.1 photosystem II proteinM (chloroplast)
           [Aconitum ciliare] AOS85988.1 photosystem II proteinM
           (chloroplast) [Aconitum coreanum] AOS86073.1 photosystem
           II proteinM (chloroplast) [Aconitum jaluense subsp.
           jaluense] AOS86158.1 photosystem II proteinM
           (chloroplast) [Aconitum jaluense subsp. jaluense]
           AOS86243.1 photosystem II proteinM (chloroplast)
           [Aconitum japonicum subsp. napiforme] AOS86328.1
           photosystem II proteinM (chloroplast) [Aconitum
           kusnezoffii] AOS86413.1 photosystem II proteinM
           (chloroplast) [Aconitum monanthum] AOS86739.1
           photosystem II protein M (chloroplast) [Joinvillea
           ascendens] AOV63471.1 PsbM (chloroplast) [Avena
           sterilis] AOV63576.1 photosystem II protein M
           (chloroplast) [Ranunculus occidentalis] AOW32199.1
           photosystem II M protein (chloroplast) [Mentha
           longifolia] AOW68888.1 photosystem II protein M
           (chloroplast) [Ranunculus austro-oreganus] AOX12913.1
           photosystem II protein M (chloroplast) [Cocos nucifera]
           AOX13123.1 photosystem II protein M (chloroplast)
           [Fagopyrum tataricum] AOX22859.1 photosystem II protein
           M (chloroplast) [Mikania micrantha] AOY40696.1
           photosystem II protein M (chloroplast) [Trollius
           chinensis] AOY41521.1 photosystem II protein M
           (chloroplast) [Haberlea rhodopensis] AOY41698.1
           photosystem II protein M (chloroplast) [Galinsoga
           quadriradiata] APA17499.1 photosystem II protein M
           (chloroplast) [Dracocephalum palmatum] APA19113.1
           photosystem II protein M (plastid) [Alniphyllum
           eberhardtii] APD83324.1 photosystem II protein M
           (chloroplast) [Carthamus tinctorius] APO11209.1
           photosystem II protein M (chloroplast) [Albuca kirkii]
           APS85500.1 PSII low MW protein M (chloroplast) [Pouteria
           campechiana] APS85585.1 PSII low MW protein M
           (chloroplast) [Diospyros blancoi] APS87140.1 photosystem
           II protein M (chloroplast) [Carpinus putoensis]
           APT41629.1 PsbM (chloroplast) [Capsicum galapagoense]
           APT41716.1 PsbM (chloroplast) [Capsicum chinense]
           APT41803.1 PsbM (chloroplast) [Capsicum chacoense]
           APT41890.1 PsbM (chloroplast) [Capsicum tovarii]
           APT41977.1 PsbM (chloroplast) [Capsicum eximium]
           APT42314.1 PSII M protein (chloroplast) [Rehmannia
           chingii] APU52702.1 photosystem II protein M
           (chloroplast) [Castanea henryi] APY18817.1 photosystem
           II protein M (chloroplast) [Akebia quinata] APZ83133.1
           photosystem II protein M (chloroplast) [Symplocarpus
           renifolius] AQM37955.1 photosystem II protein M
           (chloroplast) [Betula nana] prf||1603356M photosystem II
           low MW protein [Oryza sativa]
          Length = 34

 Score = 66.6 bits (161), Expect = 2e-11
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34


>AKZ30297.1 photosystem II protein M (chloroplast) [Goodenia ovata]
          Length = 34

 Score = 66.2 bits (160), Expect = 3e-11
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALF+LVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFVLVPTAFLLIIYVKTVSQND 34


>YP_009108753.1 photosystem II protein M [Oncinotis tenuiloba] YP_009108583.1
           photosystem II protein M [Echites umbellatus]
           YP_009130955.1 photosystem II M protein (chloroplast)
           [Lonicera japonica] YP_009129849.1 photosystem II
           protein M (chloroplast) [Paphiopedilum armeniacum]
           YP_009186024.1 photosystem II protein M (chloroplast)
           [Gynochthodes nanlingensis] YP_009230815.1 PSII low MW
           protein (chloroplast) [Arabidopsis arenosa]
           YP_009230900.1 PSII low MW protein (chloroplast)
           [Arabidopsis cebennensis] YP_009230985.1 PSII low MW
           protein (chloroplast) [Arabidopsis pedemontana]
           YP_009257822.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenicola] YP_009257907.1 PSII low MW
           protein (chloroplast) [Arabidopsis croatica]
           YP_009257992.1 PSII low MW protein (chloroplast)
           [Arabidopsis neglecta] YP_009258077.1 PSII low MW
           protein (chloroplast) [Arabidopsis petrogena]
           YP_009258247.1 PSII low MW protein (chloroplast)
           [Arabidopsis umezawana] ADD30418.1 photosystem II
           protein M (chloroplast) [Aucuba japonica] ADD30422.1
           photosystem II protein M (chloroplast) [Lonicera
           japonica] ADD30431.1 photosystem II protein M
           (chloroplast) [Cornus florida] AHN52972.1 photosystem II
           M protein (chloroplast) [Lonicera japonica] AID52263.1
           photosystem II protein M (chloroplast) [Paphiopedilum
           armeniacum] AIW05175.1 photosystem II protein M
           (plastid) [Aganosma cymosa] AIW05260.1 photosystem II
           protein M (plastid) [Echites umbellatus] AIW05345.1
           photosystem II protein M (plastid) [Epigynum auritum]
           AIW05599.1 photosystem II protein M (plastid) [Oncinotis
           tenuiloba] AJP62104.1 photosystem II protein M
           (chloroplast) [Dianthus longicalyx] AKZ23271.1
           photosystem II protein M (plastid) [Teucrium canadense]
           ALJ02069.1 photosystem II protein M (chloroplast)
           [Paphiopedilum armeniacum] ALO71344.1 photosystem II
           protein M (chloroplast) [Gynochthodes nanlingensis]
           CUA65143.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CUA65228.1 PSII low MW protein
           (chloroplast) [Arabidopsis cebennensis] CUA65313.1 PSII
           low MW protein (chloroplast) [Arabidopsis halleri subsp.
           halleri] CUA65398.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. lyrata] CUA65483.1 PSII low
           MW protein (chloroplast) [Arabidopsis pedemontana]
           CZF87570.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenicola] CZF87655.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenicola] CZF87740.1 PSII
           low MW protein (chloroplast) [Arabidopsis arenicola]
           CZF87825.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF87910.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF87995.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF88080.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF88165.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF88250.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF88335.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF88420.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF88505.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF88590.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF88675.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF88760.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF88845.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF88930.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF89015.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF89100.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF89185.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF89270.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF89355.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF89440.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF89525.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF89610.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF89695.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF89780.1 PSII low
           MW protein (chloroplast) [Arabidopsis cebennensis]
           CZF89865.1 PSII low MW protein (chloroplast)
           [Arabidopsis cebennensis] CZF89950.1 PSII low MW protein
           (chloroplast) [Arabidopsis croatica] CZF90035.1 PSII low
           MW protein (chloroplast) [Arabidopsis croatica]
           CZF90120.1 PSII low MW protein (chloroplast)
           [Arabidopsis halleri subsp. dacica] CZF90205.1 PSII low
           MW protein (chloroplast) [Arabidopsis halleri subsp.
           gemmifera] CZF90290.1 PSII low MW protein (chloroplast)
           [Arabidopsis halleri subsp. gemmifera] CZF90375.1 PSII
           low MW protein (chloroplast) [Arabidopsis halleri subsp.
           halleri] CZF90460.1 PSII low MW protein (chloroplast)
           [Arabidopsis halleri subsp. halleri] CZF90545.1 PSII low
           MW protein (chloroplast) [Arabidopsis halleri subsp.
           ovirensis] CZF90630.1 PSII low MW protein (chloroplast)
           [Arabidopsis halleri subsp. ovirensis] CZF90715.1 PSII
           low MW protein (chloroplast) [Arabidopsis halleri subsp.
           tatrica] CZF90800.1 PSII low MW protein (chloroplast)
           [Arabidopsis halleri subsp. tatrica] CZF90885.1 PSII low
           MW protein (chloroplast) [Arabidopsis kamchatica subsp.
           kamchatica] CZF90970.1 PSII low MW protein (chloroplast)
           [Arabidopsis kamchatica subsp. kamchatica] CZF91055.1
           PSII low MW protein (chloroplast) [Arabidopsis
           kamchatica subsp. kamchatica] CZF91140.1 PSII low MW
           protein (chloroplast) [Arabidopsis kamchatica subsp.
           kawasakiana] CZF91225.1 PSII low MW protein
           (chloroplast) [Arabidopsis lyrata subsp. lyrata]
           CZF91310.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF91395.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF91480.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF91565.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF91650.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF91735.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF91820.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF91905.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF91990.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF92075.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF92160.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF92245.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF92330.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF92415.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF92500.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF92585.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF92670.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF92755.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF92840.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF92925.1 PSII low
           MW protein (chloroplast) [Arabidopsis lyrata subsp.
           petraea] CZF93010.1 PSII low MW protein (chloroplast)
           [Arabidopsis lyrata subsp. petraea] CZF93095.1 PSII low
           MW protein (chloroplast) [Arabidopsis neglecta subsp.
           neglecta] CZF93180.1 PSII low MW protein (chloroplast)
           [Arabidopsis neglecta subsp. neglecta] CZF93265.1 PSII
           low MW protein (chloroplast) [Arabidopsis neglecta
           subsp. neglecta] CZF93350.1 PSII low MW protein
           (chloroplast) [Arabidopsis neglecta subsp. neglecta]
           CZF93435.1 PSII low MW protein (chloroplast)
           [Arabidopsis neglecta] CZF93520.1 PSII low MW protein
           (chloroplast) [Arabidopsis neglecta] CZF93605.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF93690.1 PSII low MW protein (chloroplast)
           [Arabidopsis arenosa] CZF93775.1 PSII low MW protein
           (chloroplast) [Arabidopsis arenosa] CZF93860.1 PSII low
           MW protein (chloroplast) [Arabidopsis arenosa]
           CZF93945.1 PSII low MW protein (chloroplast)
           [Arabidopsis pedemontana] CZF94030.1 PSII low MW protein
           (chloroplast) [Arabidopsis petraea subsp.
           septentrionalis] CZF94115.1 PSII low MW protein
           (chloroplast) [Arabidopsis petraea subsp.
           septentrionalis] CZF94200.1 PSII low MW protein
           (chloroplast) [Arabidopsis petraea subsp. umbrosa]
           CZF94285.1 PSII low MW protein (chloroplast)
           [Arabidopsis petraea subsp. umbrosa] CZF94370.1 PSII low
           MW protein (chloroplast) [Arabidopsis petrogena]
           CZF94455.1 PSII low MW protein (chloroplast)
           [Arabidopsis petrogena] CZF94540.1 PSII low MW protein
           (chloroplast) [Arabidopsis petrogena] CZF94625.1 PSII
           low MW protein (chloroplast) [Arabidopsis petrogena]
           CZF94710.1 PSII low MW protein (chloroplast)
           [Arabidopsis petrogena] CZF95050.1 PSII low MW protein
           (chloroplast) [Arabidopsis umezawana] ANY60184.1
           photosystem II protein M (chloroplast) [Arabidopsis
           lyrata] BAW02980.1 photosystem II protein M
           (chloroplast) [Arabidopsis lyrata subsp. lyrata]
          Length = 34

 Score = 66.2 bits (160), Expect = 3e-11
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTISQND 34


>YP_740644.1 photosystem II protein M [Nandina domestica] YP_001123024.1 PSII
           low MW protein [Aethionema grandiflorum] YP_001122940.1
           PSII low MW protein [Aethionema cordifolium]
           YP_001531271.1 psbM gene product (chloroplast) [Lolium
           perenne] YP_002364490.1 photosystem II protein M
           (chloroplast) [Festuca arundinacea] YP_007026541.1
           photosystem II protein M [Festuca ovina] YP_007026455.1
           photosystem II protein M [Festuca altissima]
           YP_007026627.1 photosystem II protein M [Festuca
           pratensis] YP_007026713.1 photosystem II protein M
           [Lolium multiflorum] YP_007025906.1 photosystem II
           protein M [Vaccinium macrocarpon] YP_008592633.1
           photosystem II protein M (chloroplast) [Berberis bealei]
           YP_009115889.1 photosystem II protein M [Scrophularia
           takesimensis] YP_009155944.1 photosystem II protein M
           (plastid) [Ammophila breviligulata] YP_009156111.1
           photosystem II protein M (plastid) [Anthoxanthum
           odoratum] YP_009156278.1 photosystem II protein M
           (plastid) [Helictochloa hookeri] YP_009156447.1
           photosystem II protein M (plastid) [Briza maxima]
           YP_009156531.1 photosystem II protein M (plastid)
           [Bromus vulgaris] YP_009156780.1 photosystem II protein
           M (plastid) [Anthoxanthum nitens] YP_009157530.1
           photosystem II protein M (plastid) [Poa palustris]
           YP_009157614.1 photosystem II protein M (plastid)
           [Puccinellia nuttalliana] YP_009157782.1 photosystem II
           protein M (plastid) [Trisetum cernuum] YP_009251450.1
           PsbM (chloroplast) [Berberis amurensis] YP_009251544.1
           PsbM (chloroplast) [Berberis koreana] YP_009309619.1
           PSII M protein (chloroplast) [Scrophularia buergeriana]
           YP_009317111.1 PsbM (chloroplast) [Allium sativum]
           YP_009326512.1 photosystem II protein M (chloroplast)
           [Sinadoxa corydalifolia] Q09FW7.1 RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M A4QJA9.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M A4QJJ3.1
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M A8Y9F8.1 RecName: Full=Photosystem II
           reaction center protein M; Short=PSII-M ABI49857.1
           photosystem II protein M (chloroplast) [Nandina
           domestica] BAF49764.1 PSII low MW protein (chloroplast)
           [Aethionema cordifolium] BAF49848.1 PSII low MW protein
           (chloroplast) [Aethionema grandiflorum] CAO85964.1
           photosystem II protein M (chloroplast) [Lolium perenne]
           ACJ70747.1 photosystem II protein M (chloroplast)
           [Festuca arundinacea] ADD30427.1 photosystem II protein
           M (chloroplast) [Rhododendron simsii] AEY84152.1
           photosystem II protein M (chloroplast) [Vaccinium
           macrocarpon] AFI44061.1 photosystem II protein M
           (plastid) [Vaccinium macrocarpon] AFV62635.1 photosystem
           II protein M (plastid) [Festuca altissima] AFV62721.1
           photosystem II protein M (plastid) [Festuca ovina]
           AFV62807.1 photosystem II protein M (plastid) [Festuca
           pratensis] AFV62893.1 photosystem II protein M (plastid)
           [Lolium multiflorum] AGU37039.1 photosystem II protein M
           (chloroplast) [Berberis bealei] AIX89904.1 PsbM
           (chloroplast) [Berberis amurensis] AIX89998.1 PsbM
           (chloroplast) [Berberis koreana] AIX90092.1 PsbM
           (chloroplast) [Berberis amurensis var. quelpaertensis]
           AIX90186.1 PsbM (chloroplast) [Berberis amurensis var.
           latifolia] AJD00718.1 photosystem II protein M (plastid)
           [Scrophularia takesimensis] AJV88851.1 photosystem II
           protein M (plastid) [Ammophila breviligulata] AJV89018.1
           photosystem II protein M (plastid) [Anthoxanthum
           odoratum] AJV89185.1 photosystem II protein M (plastid)
           [Helictochloa hookeri] AJV89354.1 photosystem II protein
           M (plastid) [Briza maxima] AJV89438.1 photosystem II
           protein M (plastid) [Bromus vulgaris] AJV89687.1
           photosystem II protein M (plastid) [Anthoxanthum nitens]
           AJV90437.1 photosystem II protein M (plastid) [Poa
           palustris] AJV90521.1 photosystem II protein M (plastid)
           [Puccinellia nuttalliana] AJV90605.1 photosystem II
           protein M (plastid) [Festuca arundinacea] AJV90773.1
           photosystem II protein M (plastid) [Trisetum cernuum]
           AKM21679.1 PSII M protein (chloroplast) [Scrophularia
           buergeriana] AKM21766.1 PSII M protein (chloroplast)
           [Scrophularia takesimensis] AKZ23270.1 photosystem II
           protein M (plastid) [Verbascum thapsus] ALJ01896.1
           photosystem II M protein (chloroplast) [Scrophularia
           dentata] ANX10163.1 photosystem II protein M
           (chloroplast) [Triphysaria versicolor] AOG74936.1
           photosystem II protein M (chloroplast) [Poa arachnifera]
           AOG74937.1 photosystem II protein M (chloroplast) [Poa
           araratica] AOG74938.1 photosystem II protein M
           (chloroplast) [Poa asiae-minoris] AOG74939.1 photosystem
           II protein M (chloroplast) [Poa badensis] AOG74940.1
           photosystem II protein M (chloroplast) [Poa bucharica]
           AOG74941.1 photosystem II protein M (chloroplast) [Poa
           chaixii] AOG74942.1 photosystem II protein M
           (chloroplast) [Poa hybrida] AOG74943.1 photosystem II
           protein M (chloroplast) [Poa iberica] AOG74944.1
           photosystem II protein M (chloroplast) [Poa iridifolia]
           AOG74945.1 photosystem II protein M (chloroplast) [Poa
           ligularis] AOG74946.1 photosystem II protein M
           (chloroplast) [Poa macrantha] AOG74947.1 photosystem II
           protein M (chloroplast) [Poa nemoralis] AOG74948.1
           photosystem II protein M (chloroplast) [Poa nervosa]
           AOG74950.1 photosystem II protein M (chloroplast) [Poa
           pratensis] AOG74951.1 photosystem II protein M
           (chloroplast) [Poa pumila] AOG74953.1 photosystem II
           protein M (chloroplast) [Poa sibirica] AOG74954.1
           photosystem II protein M (chloroplast) [Arctopoa
           tibetica] AOG74955.1 photosystem II protein M
           (chloroplast) [Poa trivialis] AOG74956.1 photosystem II
           protein M (chloroplast) [Poa trivialis] AOW70560.1 PsbM
           (chloroplast) [Allium sativum] APD52562.1 photosystem II
           protein M (chloroplast) [Sinadoxa corydalifolia]
           APU51448.1 photosystem II protein M (chloroplast)
           [Sambucus williamsii]
          Length = 34

 Score = 66.2 bits (160), Expect = 3e-11
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALFIL+PTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFILIPTAFLLIIYVKTVSQND 34


>YP_009145255.1 photosystem II protein M (plastid) [Trillium decumbens] AKK32133.1
           photosystem II protein M (plastid) [Trillium decumbens]
          Length = 37

 Score = 66.2 bits (160), Expect = 3e-11
 Identities = 34/37 (91%), Positives = 36/37 (97%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*FD 190
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+ F+
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQNNEFE 37


>YP_008994562.1 photosystem II protein M (chloroplast) (chloroplast) [Pelargonium
           alternans] YP_009299201.1 photosystem II protein M
           (chloroplast) [Pelargonium echinatum] YP_009299395.1
           photosystem II protein M (chloroplast) [Pelargonium
           fulgidum] YP_009299492.1 photosystem II protein M
           (chloroplast) [Pelargonium incrassatum] AGV02991.1
           photosystem II protein M (chloroplast) [Pelargonium
           alternans] AJB99115.1 photosystem II protein M
           (chloroplast) [Pelargonium echinatum] AJB99309.1
           photosystem II protein M (chloroplast) [Pelargonium
           fulgidum] AJB99406.1 photosystem II protein M
           (chloroplast) [Pelargonium incrassatum]
          Length = 37

 Score = 66.2 bits (160), Expect = 3e-11
 Identities = 34/37 (91%), Positives = 36/37 (97%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*FD 190
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D F+
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQSDSFE 37


>YP_009269726.1 photosystem II protein M (plastid) [Cephalanthera humilis]
           ANT72635.1 photosystem II protein M (plastid)
           [Cephalanthera humilis]
          Length = 34

 Score = 65.9 bits (159), Expect = 4e-11
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALFILVPTAFLLI+YVKTVSQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLILYVKTVSQND 34


>AKT94751.1 photosystem II protein M (chloroplast) [Brunonia australis]
          Length = 34

 Score = 65.9 bits (159), Expect = 4e-11
 Identities = 32/34 (94%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALF+LVPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFIATALFVLVPTAFLLIIYVKTISQND 34


>YP_009114443.1 photosystem II protein M (chloroplast) [Paeonia obovata]
           YP_009251366.1 PsbM (chloroplast) [Gymnospermium
           microrrhynchum] YP_009333019.1 photosystem II protein M
           (chloroplast) [Paeonia veitchii] AHF71987.1 photosystem
           II protein M (chloroplast) [Paeonia sp. Sd0052]
           AHV83361.1 photosystem II protein M (chloroplast)
           [Paeonia obovata] AIX89820.1 PsbM (chloroplast)
           [Gymnospermium microrrhynchum] ALS20269.1 photosystem II
           protein M (chloroplast) [Paeonia veitchii]
          Length = 34

 Score = 65.9 bits (159), Expect = 4e-11
 Identities = 32/34 (94%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAFIATALFIL+PTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFIATALFILIPTAFLLIIYVKTISQND 34


>YP_008578533.1 photosystem II protein M (chloroplast) (chloroplast) [Asclepias
           nivea] YP_008578618.1 photosystem II protein M
           (chloroplast) (chloroplast) [Asclepias syriaca]
           YP_009235534.1 PsbM (chloroplast) [Cynanchum wilfordii]
           YP_009235621.1 PsbM (chloroplast) [Cynanchum
           auriculatum] ADZ52314.1 photosystem II protein M
           (chloroplast) [Asclepias syriaca] AER52407.1 photosystem
           II protein M (plastid) [Asclepias albicans] AER52489.1
           photosystem II protein M (plastid) [Asclepias albicans]
           AER52571.1 photosystem II protein M (plastid) [Asclepias
           coulteri] AER52653.1 photosystem II protein M (plastid)
           [Asclepias cutleri] AER52735.1 photosystem II protein M
           (plastid) [Asclepias cutleri] AER52817.1 photosystem II
           protein M (plastid) [Asclepias leptopus] AER52898.1
           photosystem II protein M (plastid) [Asclepias macrotis]
           AER52978.1 photosystem II protein M (plastid) [Asclepias
           macrotis] AER53056.1 photosystem II protein M (plastid)
           [Asclepias masonii] AER53138.1 photosystem II protein M
           (plastid) [Asclepias subaphylla] AER53220.1 photosystem
           II protein M (plastid) [Asclepias subaphylla] AER53298.1
           photosystem II protein M (plastid) [Asclepias subulata]
           AER53380.1 photosystem II protein M (plastid) [Asclepias
           subulata] AER53462.1 photosystem II protein M (plastid)
           [Asclepias albicans x Asclepias subulata] AGW04358.1
           photosystem II protein M (plastid) [Araujia sericifera]
           AGW04435.1 photosystem II protein M (plastid)
           [Astephanus triflorus] AGW04661.1 photosystem II protein
           M (plastid) [Matelea biflora] AGW04738.1 photosystem II
           protein M (plastid) [Orthosia scoparia] AGW04969.1
           photosystem II protein M (plastid) [Vincetoxicum
           rossicum] AGW05113.1 photosystem II protein M
           (chloroplast) (chloroplast) [Asclepias nivea] AGW05131.1
           photosystem II protein M (chloroplast) (chloroplast)
           [Asclepias syriaca] AKZ23245.1 photosystem II protein M
           (plastid) [Asclepias verticillata] AMD38375.1 PsbM
           (chloroplast) [Cynanchum wilfordii] AMD38462.1 PsbM
           (chloroplast) [Cynanchum auriculatum]
          Length = 34

 Score = 65.9 bits (159), Expect = 4e-11
 Identities = 32/34 (94%), Positives = 34/34 (100%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 199
           MEVNILAF+ATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFVATALFILVPTAFLLIIYVKTISQND 34


>ANZ02095.1 photosystem II protein M (chloroplast) [Dendrobium nobile]
          Length = 37

 Score = 65.9 bits (159), Expect = 4e-11
 Identities = 34/37 (91%), Positives = 35/37 (94%)
 Frame = -3

Query: 300 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*FD 190
           MEVNILA IATALFILVPTAFLLIIYVKTVSQND F+
Sbjct: 1   MEVNILALIATALFILVPTAFLLIIYVKTVSQNDXFE 37


Top