BLASTX nr result
ID: Alisma22_contig00009802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00009802 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OEL18645.1 hypothetical protein BAE44_0020337 [Dichanthelium oli... 55 2e-07 XP_002458439.1 hypothetical protein SORBIDRAFT_03g033585, partia... 57 3e-07 XP_017253134.1 PREDICTED: FBD-associated F-box protein At4g10400... 57 3e-07 KXG33304.1 hypothetical protein SORBI_003G284600 [Sorghum bicolor] 57 3e-07 OEL17609.1 hypothetical protein BAE44_0021371 [Dichanthelium oli... 57 3e-07 XP_015695408.1 PREDICTED: putative F-box/FBD/LRR-repeat protein ... 56 6e-07 XP_020156640.1 FBD-associated F-box protein At5g60610-like [Aegi... 56 6e-07 XP_015695404.1 PREDICTED: F-box/FBD/LRR-repeat protein At1g13570... 56 6e-07 BAS74171.1 Os01g0730200, partial [Oryza sativa Japonica Group] 55 8e-07 EEE55335.1 hypothetical protein OsJ_03343 [Oryza sativa Japonica... 55 9e-07 EEC71424.1 hypothetical protein OsI_03614 [Oryza sativa Indica G... 55 9e-07 XP_004969833.1 PREDICTED: F-box/LRR-repeat protein At4g14103-lik... 55 1e-06 XP_004969832.1 PREDICTED: F-box/LRR-repeat protein At4g14103-lik... 55 1e-06 OEL15305.1 hypothetical protein BAE44_0023674 [Dichanthelium oli... 55 1e-06 CDM86113.1 unnamed protein product [Triticum aestivum] 55 2e-06 KQL05729.1 hypothetical protein SETIT_004518mg, partial [Setaria... 54 2e-06 XP_003569727.1 PREDICTED: putative F-box/FBD/LRR-repeat protein ... 54 2e-06 KQK08596.1 hypothetical protein BRADI_2g42749, partial [Brachypo... 52 3e-06 EEC76783.1 hypothetical protein OsI_14883 [Oryza sativa Indica G... 54 3e-06 EAZ29780.1 hypothetical protein OsJ_13838 [Oryza sativa Japonica... 54 3e-06 >OEL18645.1 hypothetical protein BAE44_0020337 [Dichanthelium oligosanthes] Length = 121 Score = 55.1 bits (131), Expect = 2e-07 Identities = 31/74 (41%), Positives = 44/74 (59%) Frame = -3 Query: 224 LAYISAARPSSQQINPMADSIKLH*SIRTESKMGNGADRISELPDAILVGILSRLPMKQV 45 L ++ A PS P++ + L ++ E + G G DRIS LPD +L +L+RLP K Sbjct: 22 LGFLYAFLPSP----PVSAAAILSCAVAPEPEGGEGVDRISALPDDLLRHVLARLPAKDG 77 Query: 44 ARVGILSRRWRGLY 3 AR LS+RWRGL+ Sbjct: 78 ARTAALSKRWRGLW 91 >XP_002458439.1 hypothetical protein SORBIDRAFT_03g033585, partial [Sorghum bicolor] Length = 405 Score = 56.6 bits (135), Expect = 3e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -3 Query: 125 GNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 G+G DRIS+LPDA+L+ +LS LP++ R +LS RWRGL+ Sbjct: 85 GDGRDRISDLPDAVLLSVLSLLPLRDAGRTAVLSSRWRGLF 125 >XP_017253134.1 PREDICTED: FBD-associated F-box protein At4g10400-like [Daucus carota subsp. sativus] Length = 446 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 134 SKMGNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGL 6 SK N DRISELPD++LV ILS LP+K AR +LS+RWR L Sbjct: 5 SKTSNKIDRISELPDSLLVNILSLLPIKSAARTSVLSKRWRPL 47 >KXG33304.1 hypothetical protein SORBI_003G284600 [Sorghum bicolor] Length = 530 Score = 56.6 bits (135), Expect = 3e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -3 Query: 125 GNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 G+G DRIS+LPDA+L+ +LS LP++ R +LS RWRGL+ Sbjct: 87 GDGRDRISDLPDAVLLSVLSLLPLRDAGRTAVLSSRWRGLF 127 >OEL17609.1 hypothetical protein BAE44_0021371 [Dichanthelium oligosanthes] Length = 707 Score = 56.6 bits (135), Expect = 3e-07 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -3 Query: 146 IRTESK-MGNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 +RT + G+G DRIS+LPDA+L+ +LS LP++ R +LS RWRGL+ Sbjct: 76 VRTADRPAGDGRDRISDLPDAVLLSVLSFLPLRDAGRTAVLSSRWRGLF 124 >XP_015695408.1 PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 isoform X2 [Oryza brachyantha] Length = 431 Score = 55.8 bits (133), Expect = 6e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 125 GNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 G+G DRIS+LPDAILV ILS LP + AR +LS RWR L+ Sbjct: 92 GDGRDRISDLPDAILVSILSFLPFRDAARTAVLSWRWRNLF 132 >XP_020156640.1 FBD-associated F-box protein At5g60610-like [Aegilops tauschii subsp. tauschii] Length = 495 Score = 55.8 bits (133), Expect = 6e-07 Identities = 32/75 (42%), Positives = 43/75 (57%) Frame = -3 Query: 227 CLAYISAARPSSQQINPMADSIKLH*SIRTESKMGNGADRISELPDAILVGILSRLPMKQ 48 CL ++ + ++P A H S T S +G DRIS LPD +L ++SRLP+K Sbjct: 8 CLEHVMDCCFPASPVSPNA-----HLSAATSST--DGEDRISPLPDTLLRNVVSRLPVKD 60 Query: 47 VARVGILSRRWRGLY 3 AR G LS RWRGL+ Sbjct: 61 AARTGALSHRWRGLW 75 >XP_015695404.1 PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Oryza brachyantha] Length = 534 Score = 55.8 bits (133), Expect = 6e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 125 GNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 G+G DRIS+LPDAILV ILS LP + AR +LS RWR L+ Sbjct: 92 GDGRDRISDLPDAILVSILSFLPFRDAARTAVLSWRWRNLF 132 >BAS74171.1 Os01g0730200, partial [Oryza sativa Japonica Group] Length = 359 Score = 55.5 bits (132), Expect = 8e-07 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -3 Query: 137 ESKMGNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 ++ G+G DRIS+LPDA+L+ ILS LP + R +LSRRWR L+ Sbjct: 71 DAAAGDGRDRISDLPDAVLLSILSFLPFRDAGRTAVLSRRWRKLF 115 >EEE55335.1 hypothetical protein OsJ_03343 [Oryza sativa Japonica Group] Length = 497 Score = 55.5 bits (132), Expect = 9e-07 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -3 Query: 137 ESKMGNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 ++ G+G DRIS+LPDA+L+ ILS LP + R +LSRRWR L+ Sbjct: 73 DAAAGDGRDRISDLPDAVLLSILSFLPFRDAGRTAVLSRRWRKLF 117 >EEC71424.1 hypothetical protein OsI_03614 [Oryza sativa Indica Group] Length = 516 Score = 55.5 bits (132), Expect = 9e-07 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -3 Query: 137 ESKMGNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 ++ G+G DRIS+LPDA+L+ ILS LP + R +LSRRWR L+ Sbjct: 73 DAAAGDGRDRISDLPDAVLLSILSFLPFRDAGRTAVLSRRWRKLF 117 >XP_004969833.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X2 [Setaria italica] Length = 489 Score = 55.1 bits (131), Expect = 1e-06 Identities = 22/41 (53%), Positives = 32/41 (78%) Frame = -3 Query: 125 GNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 G+G DRIS+LPDA+L+ +LS +P++ R +LS RWRGL+ Sbjct: 84 GDGRDRISDLPDAVLLSVLSFVPLRDAGRTAVLSSRWRGLF 124 >XP_004969832.1 PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Setaria italica] KQL06827.1 hypothetical protein SETIT_001013mg [Setaria italica] Length = 523 Score = 55.1 bits (131), Expect = 1e-06 Identities = 22/41 (53%), Positives = 32/41 (78%) Frame = -3 Query: 125 GNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 G+G DRIS+LPDA+L+ +LS +P++ R +LS RWRGL+ Sbjct: 84 GDGRDRISDLPDAVLLSVLSFVPLRDAGRTAVLSSRWRGLF 124 >OEL15305.1 hypothetical protein BAE44_0023674 [Dichanthelium oligosanthes] Length = 531 Score = 55.1 bits (131), Expect = 1e-06 Identities = 30/70 (42%), Positives = 41/70 (58%) Frame = -3 Query: 212 SAARPSSQQINPMADSIKLH*SIRTESKMGNGADRISELPDAILVGILSRLPMKQVARVG 33 S S+ + AD LH + +G+G D IS LPDA+L I+SRLP K+ AR Sbjct: 64 SLTSSDSEASDAGADPPPLH-----PAALGDGEDNISRLPDALLSNIVSRLPTKEAARTV 118 Query: 32 ILSRRWRGLY 3 +LS RWRG++ Sbjct: 119 VLSTRWRGVW 128 >CDM86113.1 unnamed protein product [Triticum aestivum] Length = 528 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 122 NGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 +G DRIS LPDA+L GI+SRLP K VAR LS RWR L+ Sbjct: 65 DGVDRISRLPDAVLRGIVSRLPAKDVARTAALSSRWRPLW 104 >KQL05729.1 hypothetical protein SETIT_004518mg, partial [Setaria italica] Length = 499 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -3 Query: 122 NGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 +G DRIS LPD IL ++SRLP+K AR G L+ RWRGL+ Sbjct: 44 DGVDRISSLPDGILRNVVSRLPVKDAARTGALASRWRGLW 83 >XP_003569727.1 PREDICTED: putative F-box/FBD/LRR-repeat protein At5g44950 [Brachypodium distachyon] KQK09582.1 hypothetical protein BRADI_2g48880 [Brachypodium distachyon] Length = 511 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 122 NGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 +G DRISELPDAILV ILS LP++ AR +LS RWR L+ Sbjct: 70 DGRDRISELPDAILVSILSYLPLRDAARSTVLSSRWRHLF 109 >KQK08596.1 hypothetical protein BRADI_2g42749, partial [Brachypodium distachyon] Length = 110 Score = 51.6 bits (122), Expect = 3e-06 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = -3 Query: 149 SIRTESKMGNGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 S+ S M +G DRIS LPDA+L I+SRLP K AR L+ RWR L+ Sbjct: 53 SLHGASWMPDGVDRISRLPDALLRDIVSRLPAKDAARTAALASRWRPLW 101 >EEC76783.1 hypothetical protein OsI_14883 [Oryza sativa Indica Group] Length = 399 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 122 NGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 +G DRIS LPDAIL I+SRLP+K AR LSRRWR L+ Sbjct: 65 DGVDRISALPDAILRNIVSRLPVKDAARTAALSRRWRPLW 104 >EAZ29780.1 hypothetical protein OsJ_13838 [Oryza sativa Japonica Group] Length = 498 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -3 Query: 122 NGADRISELPDAILVGILSRLPMKQVARVGILSRRWRGLY 3 +G DRIS LPDAIL I+SRLP+K AR LSRRWR L+ Sbjct: 65 DGVDRISALPDAILRNIVSRLPVKDAARTAALSRRWRPLW 104