BLASTX nr result
ID: Alisma22_contig00009424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00009424 (888 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADB96021.1 putative nucleic acid binding protein, partial [Frees... 87 2e-17 KVH89590.1 hypothetical protein Ccrd_008428 [Cynara cardunculus ... 86 4e-17 XP_009377932.1 PREDICTED: glycine-rich cell wall structural prot... 85 1e-16 XP_010941946.1 PREDICTED: heterogeneous nuclear ribonucleoprotei... 84 2e-16 GAV77543.1 hypothetical protein CFOL_v3_21014 [Cephalotus follic... 86 4e-16 XP_002305007.2 hypothetical protein POPTR_0004s03670g [Populus t... 84 4e-16 XP_008383802.1 PREDICTED: putative glycine-rich cell wall struct... 83 6e-16 XP_008796987.1 PREDICTED: glycine-rich protein 2-like [Phoenix d... 82 1e-15 XP_002317234.1 glycine-rich family protein [Populus trichocarpa]... 82 1e-15 XP_011043255.1 PREDICTED: cold shock domain-containing protein 4... 82 1e-15 XP_011027929.1 PREDICTED: eggshell protein 1-like [Populus euphr... 83 1e-15 XP_020092592.1 putative glycine-rich cell wall structural protei... 82 1e-15 XP_010268788.1 PREDICTED: holotricin-3 [Nelumbo nucifera] 82 2e-15 CDO99610.1 unnamed protein product [Coffea canephora] 80 3e-15 XP_010646777.1 PREDICTED: cold shock domain-containing protein 4... 81 4e-15 XP_002521418.1 PREDICTED: 5'-3' exoribonuclease 2 [Ricinus commu... 80 5e-15 XP_010057475.1 PREDICTED: glycine-rich cell wall structural prot... 81 5e-15 XP_006841752.1 PREDICTED: eggshell protein 2A [Amborella trichop... 80 5e-15 XP_010696588.1 PREDICTED: glycine-rich protein 2 [Beta vulgaris ... 80 6e-15 XP_010430140.1 PREDICTED: glycine-rich protein 2-like [Camelina ... 80 6e-15 >ADB96021.1 putative nucleic acid binding protein, partial [Freesia refracta] Length = 137 Score = 86.7 bits (213), Expect = 2e-17 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 RPSTVC KGPCYKKKL CP KCF S++ SG+NY GCT+DC KCVAYC Sbjct: 84 RPSTVCSEKGPCYKKKLTCPAKCFTSYNRSGRNYGSGGGGGGCTMDCKKCVAYC 137 >KVH89590.1 hypothetical protein Ccrd_008428 [Cynara cardunculus var. scolymus] Length = 143 Score = 85.9 bits (211), Expect = 4e-17 Identities = 36/54 (66%), Positives = 40/54 (74%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 RP+ VCK+KGPCYKKKL CP KCF S+S SGK Y GCT+DC KCVAYC Sbjct: 90 RPTVVCKDKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTMDCKKCVAYC 143 >XP_009377932.1 PREDICTED: glycine-rich cell wall structural protein 1.8-like isoform X1 [Pyrus x bretschneideri] XP_009377989.1 PREDICTED: glycine-rich cell wall structural protein 1.8-like isoform X2 [Pyrus x bretschneideri] Length = 148 Score = 84.7 bits (208), Expect = 1e-16 Identities = 37/56 (66%), Positives = 38/56 (67%) Frame = -1 Query: 567 TTRPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 T R S VCK KGPCYKKKL CP KCF S+S SGK Y GCTIDC KC AYC Sbjct: 93 TVRTSLVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTIDCKKCTAYC 148 >XP_010941946.1 PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 1-like [Elaeis guineensis] Length = 140 Score = 84.3 bits (207), Expect = 2e-16 Identities = 36/54 (66%), Positives = 38/54 (70%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 +PS VC KGPCYKKKL CP KCF S+S SGK Y GCTIDC KCVAYC Sbjct: 87 QPSVVCSEKGPCYKKKLTCPAKCFTSYSHSGKGYGGGGGGGGCTIDCKKCVAYC 140 >GAV77543.1 hypothetical protein CFOL_v3_21014 [Cephalotus follicularis] Length = 239 Score = 85.9 bits (211), Expect = 4e-16 Identities = 39/55 (70%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 RP+TVCK KGPCY KKLACPTKCF S+SSSGK Y GCT+DC KCVAYC Sbjct: 185 RPTTVCKEKGPCYMKKLACPTKCFTSYSSSGKGYGGGGGGGGCTMDCKKKCVAYC 239 >XP_002305007.2 hypothetical protein POPTR_0004s03670g [Populus trichocarpa] EEE85518.2 hypothetical protein POPTR_0004s03670g [Populus trichocarpa] Length = 179 Score = 84.3 bits (207), Expect = 4e-16 Identities = 36/54 (66%), Positives = 38/54 (70%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 RPS VCK +GPCYKKKL CP KCF S S SGK Y GCT+DC KCVAYC Sbjct: 126 RPSVVCKERGPCYKKKLTCPAKCFTSHSRSGKGYGGGGGGGGCTLDCKKCVAYC 179 >XP_008383802.1 PREDICTED: putative glycine-rich cell wall structural protein 1 [Malus domestica] Length = 153 Score = 83.2 bits (204), Expect = 6e-16 Identities = 36/56 (64%), Positives = 38/56 (67%) Frame = -1 Query: 567 TTRPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 T R S VCK KGPCYKKKL CP KCF S+S SGK + GCTIDC KC AYC Sbjct: 98 TVRTSLVCKEKGPCYKKKLTCPAKCFTSYSRSGKGFGGGGGGGGCTIDCKKCTAYC 153 >XP_008796987.1 PREDICTED: glycine-rich protein 2-like [Phoenix dactylifera] Length = 151 Score = 82.4 bits (202), Expect = 1e-15 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 RPS VC KGPCYKKKL CP KCF S++ SGK Y GCT+DC KCV+YC Sbjct: 98 RPSVVCSEKGPCYKKKLTCPAKCFTSYTRSGKGYGGGGGGGGCTMDCKKCVSYC 151 >XP_002317234.1 glycine-rich family protein [Populus trichocarpa] EEE97846.1 glycine-rich family protein [Populus trichocarpa] Length = 142 Score = 82.0 bits (201), Expect = 1e-15 Identities = 37/55 (67%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 +PS VCK KGPCYKKKL CP KCF S+S SGK Y GCTIDC KCVAYC Sbjct: 88 KPSVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTIDCKKKCVAYC 142 >XP_011043255.1 PREDICTED: cold shock domain-containing protein 4-like [Populus euphratica] Length = 144 Score = 82.0 bits (201), Expect = 1e-15 Identities = 37/55 (67%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 +PS VCK KGPCYKKKL CP KCF S+S SGK Y GCTIDC KCVAYC Sbjct: 90 KPSVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTIDCKKKCVAYC 144 >XP_011027929.1 PREDICTED: eggshell protein 1-like [Populus euphratica] Length = 188 Score = 83.2 bits (204), Expect = 1e-15 Identities = 35/54 (64%), Positives = 38/54 (70%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 RPS VC+ +GPCYKKKL CP KCF S S SGK Y GCT+DC KCVAYC Sbjct: 135 RPSVVCRERGPCYKKKLTCPAKCFTSHSRSGKGYGGGGGGGGCTLDCKKCVAYC 188 >XP_020092592.1 putative glycine-rich cell wall structural protein 1 [Ananas comosus] Length = 137 Score = 81.6 bits (200), Expect = 1e-15 Identities = 36/55 (65%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNK-CVAYC 400 RPS VC +GPCYKK+L CP KCF S+S SGKNY GCTIDC K CVAYC Sbjct: 83 RPSVVCSERGPCYKKRLTCPAKCFSSYSRSGKNYGSGGGGGGCTIDCKKRCVAYC 137 >XP_010268788.1 PREDICTED: holotricin-3 [Nelumbo nucifera] Length = 158 Score = 81.6 bits (200), Expect = 2e-15 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 RP+ VC ++GPCYKKKL CP KCF S+S SGKNY GCTIDC KCVAYC Sbjct: 104 RPTVVCNDRGPCYKKKLTCPAKCFTSYSHSGKNYGSGGGGGGCTIDCKKKCVAYC 158 >CDO99610.1 unnamed protein product [Coffea canephora] Length = 133 Score = 80.5 bits (197), Expect = 3e-15 Identities = 36/55 (65%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNK-CVAYC 400 RP+ VCK KGPCYKKKL CP KCF S+S SGK Y GCT+DC K CVAYC Sbjct: 79 RPTVVCKEKGPCYKKKLICPAKCFSSFSRSGKGYGAGGGGGGCTMDCKKNCVAYC 133 >XP_010646777.1 PREDICTED: cold shock domain-containing protein 4-like [Vitis vinifera] Length = 155 Score = 80.9 bits (198), Expect = 4e-15 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 567 TTRPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 T RP+ VCK KGPCY KKL CP KCF S+S SGKNY GCT+DC KC AYC Sbjct: 99 TIRPTVVCKEKGPCYMKKLTCPAKCFTSYSRSGKNYGAGGGGGGCTMDCKKKCTAYC 155 >XP_002521418.1 PREDICTED: 5'-3' exoribonuclease 2 [Ricinus communis] EEF40908.1 nucleic acid binding protein, putative [Ricinus communis] Length = 147 Score = 80.5 bits (197), Expect = 5e-15 Identities = 35/55 (63%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 RP+ VCK KGPCYKKKL CP KCF S+S SGK Y GCT+DC KC+AYC Sbjct: 93 RPTVVCKEKGPCYKKKLTCPAKCFTSYSRSGKGYGGGGGGGGCTMDCKKKCIAYC 147 >XP_010057475.1 PREDICTED: glycine-rich cell wall structural protein 2-like [Eucalyptus grandis] Length = 164 Score = 80.9 bits (198), Expect = 5e-15 Identities = 35/55 (63%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 RP+ VCK+KGPCYKKKL CP KCF S+S SGK Y GCT+DC KC+AYC Sbjct: 110 RPTVVCKDKGPCYKKKLTCPAKCFTSYSRSGKGYGSGGGGGGCTMDCKKKCIAYC 164 >XP_006841752.1 PREDICTED: eggshell protein 2A [Amborella trichopoda] ERN03427.1 hypothetical protein AMTR_s00003p00261880 [Amborella trichopoda] Length = 151 Score = 80.5 bits (197), Expect = 5e-15 Identities = 36/55 (65%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 RP+ VC GPCYKKKL CP KCFKS+S SGKNY GCT+DC KCVAYC Sbjct: 97 RPTVVCSAPGPCYKKKLVCPAKCFKSFSKSGKNYGSGGGGGGCTMDCKKKCVAYC 151 >XP_010696588.1 PREDICTED: glycine-rich protein 2 [Beta vulgaris subsp. vulgaris] KMS96772.1 hypothetical protein BVRB_8g199550 [Beta vulgaris subsp. vulgaris] Length = 142 Score = 80.1 bits (196), Expect = 6e-15 Identities = 37/57 (64%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 567 TTRPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDC-NKCVAYC 400 T RPS VCK KGPCY KKL CP KCF S+S SGK Y GCT+DC KCVAYC Sbjct: 86 TIRPSMVCKEKGPCYMKKLMCPAKCFTSFSRSGKGYGGGGGGGGCTMDCKKKCVAYC 142 >XP_010430140.1 PREDICTED: glycine-rich protein 2-like [Camelina sativa] Length = 157 Score = 80.5 bits (197), Expect = 6e-15 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -1 Query: 561 RPSTVCKNKGPCYKKKLACPTKCFKSWSSSGKNYXXXXXXXGCTIDCNKCVAYC 400 RP+ +CK KG C+ KKL CP KCFKS+S SGK Y GCTIDC KCVAYC Sbjct: 104 RPTVICKEKGHCHMKKLTCPAKCFKSFSRSGKGYGGGGGGGGCTIDCKKCVAYC 157