BLASTX nr result
ID: Alisma22_contig00009341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00009341 (796 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KQL23842.1 hypothetical protein SETIT_029964mg [Setaria italica] 58 5e-06 >KQL23842.1 hypothetical protein SETIT_029964mg [Setaria italica] Length = 344 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 130 LQQVHDEREMDRVLAIDGIQLIGINNRSLGKHY 228 L +VHDERE+DRVL IDG+QLIGINNRSLG +Y Sbjct: 312 LVEVHDERELDRVLKIDGVQLIGINNRSLGTYY 344