BLASTX nr result
ID: Alisma22_contig00009275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00009275 (866 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY53734.1 hypothetical protein MANES_03G019500 [Manihot esculenta] 58 2e-07 XP_010088830.1 hypothetical protein L484_020813 [Morus notabilis... 58 2e-07 XP_009107136.1 PREDICTED: uncharacterized protein LOC103832796 [... 56 8e-07 XP_013626551.1 PREDICTED: uncharacterized protein LOC106332614 [... 56 9e-07 KJB64882.1 hypothetical protein B456_010G069800 [Gossypium raimo... 56 9e-07 KQK10064.1 hypothetical protein BRADI_2g51716 [Brachypodium dist... 55 2e-06 KJB06145.1 hypothetical protein B456_001G004700 [Gossypium raimo... 55 2e-06 EOY30820.1 Uncharacterized protein TCM_037899 [Theobroma cacao] 55 3e-06 ERN07866.1 hypothetical protein AMTR_s00012p00214100 [Amborella ... 55 3e-06 XP_007152821.1 hypothetical protein PHAVU_004G162600g [Phaseolus... 54 3e-06 OIT37911.1 hypothetical protein A4A49_11552 [Nicotiana attenuata] 55 3e-06 KHN20688.1 hypothetical protein glysoja_019005 [Glycine soja] KR... 54 3e-06 XP_009786429.1 PREDICTED: uncharacterized protein LOC104234552 [... 54 4e-06 KYP49330.1 hypothetical protein KK1_028968 [Cajanus cajan] 54 4e-06 KNA06885.1 hypothetical protein SOVF_176980 [Spinacia oleracea] 54 4e-06 EEF48276.1 conserved hypothetical protein [Ricinus communis] 54 6e-06 KVH93914.1 hypothetical protein Ccrd_004032 [Cynara cardunculus ... 54 6e-06 KZM83861.1 hypothetical protein DCAR_028717 [Daucus carota subsp... 54 7e-06 XP_002324414.1 hypothetical protein POPTR_0018s05880g [Populus t... 54 7e-06 KHN45655.1 hypothetical protein glysoja_031526 [Glycine soja] KR... 53 7e-06 >OAY53734.1 hypothetical protein MANES_03G019500 [Manihot esculenta] Length = 80 Score = 57.8 bits (138), Expect = 2e-07 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = +2 Query: 272 DGRARQQYCVCSPTQHPGSFRCRLHHHDYRWG 367 DG + CVCSPT+HPGSFRCR HH DY WG Sbjct: 43 DGGGSMKKCVCSPTRHPGSFRCRHHHGDYEWG 74 >XP_010088830.1 hypothetical protein L484_020813 [Morus notabilis] EXB37027.1 hypothetical protein L484_020813 [Morus notabilis] Length = 93 Score = 58.2 bits (139), Expect = 2e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = +2 Query: 275 GRARQQYCVCSPTQHPGSFRCRLHHHDYRWGGGGTAR 385 G A ++YC+CSPTQHPGSFRCR H +Y WG G R Sbjct: 53 GGAAKRYCLCSPTQHPGSFRCRQHLGEYAWGTGRVVR 89 >XP_009107136.1 PREDICTED: uncharacterized protein LOC103832796 [Brassica rapa] Length = 78 Score = 55.8 bits (133), Expect = 8e-07 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = +2 Query: 272 DGRARQQYCVCSPTQHPGSFRCRLHHHDYRW 364 DGR ++ CVCSP+ HP SF+CR HHH+Y+W Sbjct: 40 DGRGEKKKCVCSPSTHPRSFKCRYHHHEYQW 70 >XP_013626551.1 PREDICTED: uncharacterized protein LOC106332614 [Brassica oleracea var. oleracea] Length = 79 Score = 55.8 bits (133), Expect = 9e-07 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = +2 Query: 272 DGRARQQYCVCSPTQHPGSFRCRLHHHDYRW 364 DGR ++ CVCSP+ HP SF+CR HHH+Y+W Sbjct: 40 DGRGEKKKCVCSPSTHPRSFKCRYHHHEYQW 70 >KJB64882.1 hypothetical protein B456_010G069800 [Gossypium raimondii] Length = 81 Score = 55.8 bits (133), Expect = 9e-07 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +2 Query: 290 QYCVCSPTQHPGSFRCRLHHHDYRWGG 370 ++C+CSPT+HPGSFRCR HH DY WGG Sbjct: 49 KWCMCSPTKHPGSFRCRHHHADYVWGG 75 >KQK10064.1 hypothetical protein BRADI_2g51716 [Brachypodium distachyon] Length = 68 Score = 54.7 bits (130), Expect = 2e-06 Identities = 21/32 (65%), Positives = 22/32 (68%) Frame = +2 Query: 278 RARQQYCVCSPTQHPGSFRCRLHHHDYRWGGG 373 R R YCVCSPT H GSFRCR H Y+WG G Sbjct: 31 RQRHYYCVCSPTSHRGSFRCRWHRSSYQWGSG 62 >KJB06145.1 hypothetical protein B456_001G004700 [Gossypium raimondii] Length = 73 Score = 54.7 bits (130), Expect = 2e-06 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +2 Query: 266 EDDGRARQQYCVCSPTQHPGSFRCRLHHHDYRWGG 370 + +G + C+CSPT+HPGSFRCR HH +Y WGG Sbjct: 33 DTNGVGSMKQCLCSPTKHPGSFRCRHHHAEYVWGG 67 >EOY30820.1 Uncharacterized protein TCM_037899 [Theobroma cacao] Length = 84 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +2 Query: 275 GRARQQYCVCSPTQHPGSFRCRLHHHDYRWGG 370 G + C+CSPT+HPGSFRCR HH +Y WGG Sbjct: 47 GSTSMKQCLCSPTKHPGSFRCRHHHAEYVWGG 78 >ERN07866.1 hypothetical protein AMTR_s00012p00214100 [Amborella trichopoda] Length = 98 Score = 55.1 bits (131), Expect = 3e-06 Identities = 19/37 (51%), Positives = 26/37 (70%) Frame = +2 Query: 284 RQQYCVCSPTQHPGSFRCRLHHHDYRWGGGGTARQVD 394 ++ +C+CSPT+HPGSFRCR HH Y+WG T + Sbjct: 59 KKTWCICSPTRHPGSFRCRYHHKYYQWGSKRTTEDTE 95 >XP_007152821.1 hypothetical protein PHAVU_004G162600g [Phaseolus vulgaris] ESW24815.1 hypothetical protein PHAVU_004G162600g [Phaseolus vulgaris] Length = 72 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +2 Query: 269 DDGRARQQYCVCSPTQHPGSFRCRLHHHDYRWGG 370 + G A++ CVCSP+QHPGSFRCRLHH +Y W G Sbjct: 37 ESGSAKR--CVCSPSQHPGSFRCRLHHGEYVWRG 68 >OIT37911.1 hypothetical protein A4A49_11552 [Nicotiana attenuata] Length = 86 Score = 54.7 bits (130), Expect = 3e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +2 Query: 296 CVCSPTQHPGSFRCRLHHHDYRWGGG 373 CVCSPT HPGSFRCR HH DY+W G Sbjct: 54 CVCSPTHHPGSFRCRHHHSDYKWQNG 79 >KHN20688.1 hypothetical protein glysoja_019005 [Glycine soja] KRH48407.1 hypothetical protein GLYMA_07G087100 [Glycine max] Length = 76 Score = 54.3 bits (129), Expect = 3e-06 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +2 Query: 290 QYCVCSPTQHPGSFRCRLHHHDYRWGG 370 ++CVCSP+QHPGSFRCRLHH +Y W G Sbjct: 46 KHCVCSPSQHPGSFRCRLHHGEYVWIG 72 >XP_009786429.1 PREDICTED: uncharacterized protein LOC104234552 [Nicotiana sylvestris] Length = 89 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/27 (74%), Positives = 23/27 (85%) Frame = +2 Query: 284 RQQYCVCSPTQHPGSFRCRLHHHDYRW 364 R+ CVCSPT+HPGSFRCR HH DY+W Sbjct: 43 RKFQCVCSPTKHPGSFRCRHHHSDYKW 69 >KYP49330.1 hypothetical protein KK1_028968 [Cajanus cajan] Length = 76 Score = 53.9 bits (128), Expect = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = +2 Query: 296 CVCSPTQHPGSFRCRLHHHDYRWGG 370 CVCSP+QHPGSFRCRLHH +Y W G Sbjct: 48 CVCSPSQHPGSFRCRLHHAEYVWRG 72 >KNA06885.1 hypothetical protein SOVF_176980 [Spinacia oleracea] Length = 92 Score = 54.3 bits (129), Expect = 4e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = +2 Query: 275 GRARQQYCVCSPTQHPGSFRCRLHHHDYRW 364 G R++ C+CSPT HPGSFRCR HH DY W Sbjct: 52 GGERRRVCLCSPTSHPGSFRCRYHHSDYVW 81 >EEF48276.1 conserved hypothetical protein [Ricinus communis] Length = 90 Score = 53.9 bits (128), Expect = 6e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = +2 Query: 296 CVCSPTQHPGSFRCRLHHHDYRWG 367 CVCSPT+HPGSFRCR HH DY WG Sbjct: 61 CVCSPTRHPGSFRCRHHHVDYAWG 84 >KVH93914.1 hypothetical protein Ccrd_004032 [Cynara cardunculus var. scolymus] Length = 83 Score = 53.5 bits (127), Expect = 6e-06 Identities = 23/40 (57%), Positives = 26/40 (65%), Gaps = 6/40 (15%) Frame = +2 Query: 266 EDDGR------ARQQYCVCSPTQHPGSFRCRLHHHDYRWG 367 ED GR A C+CSPT HPGSFRCR HH++Y WG Sbjct: 33 EDGGRGGGASHAVTNQCLCSPTSHPGSFRCRYHHNEYIWG 72 >KZM83861.1 hypothetical protein DCAR_028717 [Daucus carota subsp. sativus] Length = 84 Score = 53.5 bits (127), Expect = 7e-06 Identities = 19/29 (65%), Positives = 23/29 (79%) Frame = +2 Query: 281 ARQQYCVCSPTQHPGSFRCRLHHHDYRWG 367 ++ Q C+CSPT HPGSFRCR HH +Y WG Sbjct: 46 SKLQQCICSPTTHPGSFRCRYHHAEYVWG 74 >XP_002324414.1 hypothetical protein POPTR_0018s05880g [Populus trichocarpa] EEF02979.1 hypothetical protein POPTR_0018s05880g [Populus trichocarpa] Length = 85 Score = 53.5 bits (127), Expect = 7e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 296 CVCSPTQHPGSFRCRLHHHDYRWGGGGTARQ 388 C+CSPT+HPGSFRCR H DY WGG T R+ Sbjct: 52 CLCSPTRHPGSFRCRHHRSDYVWGGRITRRK 82 >KHN45655.1 hypothetical protein glysoja_031526 [Glycine soja] KRH39273.1 hypothetical protein GLYMA_09G189800 [Glycine max] Length = 73 Score = 53.1 bits (126), Expect = 7e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +2 Query: 290 QYCVCSPTQHPGSFRCRLHHHDYRWGG 370 Q CVCSP+QHPGSFRCRLHH Y W G Sbjct: 43 QRCVCSPSQHPGSFRCRLHHVKYVWCG 69