BLASTX nr result
ID: Alisma22_contig00009220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00009220 (472 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018498709.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 60 4e-08 XP_008371094.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 60 8e-08 XP_007219495.1 hypothetical protein PRUPE_ppa022268mg, partial [... 59 2e-07 ONI24184.1 hypothetical protein PRUPE_2G229200 [Prunus persica] 59 2e-07 JAU90138.1 PsbP-like protein 2, chloroplastic [Noccaea caerulesc... 58 4e-07 XP_008371245.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 58 4e-07 XP_009335894.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 57 5e-07 KFK36840.1 hypothetical protein AALP_AA4G178800 [Arabis alpina] 57 7e-07 XP_009357670.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 57 7e-07 XP_008233571.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 57 8e-07 XP_009357671.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 57 1e-06 XP_018439492.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 56 1e-06 XP_011469842.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 56 2e-06 XP_018836533.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 55 3e-06 XP_004497306.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 55 3e-06 XP_010509010.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 55 3e-06 XP_006294999.1 hypothetical protein CARUB_v10024070mg [Capsella ... 55 3e-06 JAT47575.1 PsbP-like protein 2, chloroplastic [Anthurium amnicola] 54 3e-06 XP_010517301.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 55 4e-06 XP_010505625.1 PREDICTED: photosynthetic NDH subunit of lumenal ... 55 4e-06 >XP_018498709.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic-like [Pyrus x bretschneideri] Length = 234 Score = 60.5 bits (145), Expect = 4e-08 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 3/86 (3%) Frame = +2 Query: 83 PLL--FVRVCSYVLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFF 253 PLL F + + +L + L+A+EIP++FRAFVD++DGYSYYYP DWR F + + F Sbjct: 57 PLLLGFGALTTSLLHANSLLAQEIPEKFRAFVDKVDGYSYYYPNDWRDFEFRAHDSAFKD 116 Query: 254 EYSYLLYYHGQIVMLVQTFLLELYPL 331 Y L + + +T + +L P+ Sbjct: 117 RYMQLHNVRVRFIPTNKTDIHDLGPM 142 >XP_008371094.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic-like [Malus domestica] Length = 235 Score = 59.7 bits (143), Expect = 8e-08 Identities = 34/86 (39%), Positives = 51/86 (59%), Gaps = 3/86 (3%) Frame = +2 Query: 83 PLL--FVRVCSYVLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFF 253 PLL F + + +L + L A+EIP++FRAFVD++DGYSYYYP DWR F + + F Sbjct: 58 PLLLGFGALTTSLLHANSLFAQEIPEKFRAFVDKVDGYSYYYPNDWRDFEFRAHDSAFKD 117 Query: 254 EYSYLLYYHGQIVMLVQTFLLELYPL 331 Y L + + +T + +L P+ Sbjct: 118 RYMQLHNVRVRFIPTNKTDIHDLGPM 143 >XP_007219495.1 hypothetical protein PRUPE_ppa022268mg, partial [Prunus persica] Length = 221 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +2 Query: 131 LIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQIVMLVQT 307 L AEEIP+++RAFVD++DGYSYYYP DWR F + + F Y L + + +T Sbjct: 62 LFAEEIPEKYRAFVDKVDGYSYYYPYDWRDFEFRAHDSAFKDRYMQLHNVRVRFLPTNKT 121 Query: 308 FLLELYPL 331 + EL P+ Sbjct: 122 DIHELGPM 129 >ONI24184.1 hypothetical protein PRUPE_2G229200 [Prunus persica] Length = 240 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +2 Query: 131 LIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQIVMLVQT 307 L AEEIP+++RAFVD++DGYSYYYP DWR F + + F Y L + + +T Sbjct: 81 LFAEEIPEKYRAFVDKVDGYSYYYPYDWRDFEFRAHDSAFKDRYMQLHNVRVRFLPTNKT 140 Query: 308 FLLELYPL 331 + EL P+ Sbjct: 141 DIHELGPM 148 >JAU90138.1 PsbP-like protein 2, chloroplastic [Noccaea caerulescens] Length = 234 Score = 57.8 bits (138), Expect = 4e-07 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 1/69 (1%) Frame = +2 Query: 128 LLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQIVMLVQ 304 LL+AEEIP R+ AFVDR DGYSYYYP+DWR F + + F Y L + + + Sbjct: 74 LLLAEEIPKRYSAFVDRQDGYSYYYPSDWREFDFRAHDSAFKDRYLQLQNVRVRFIPTEK 133 Query: 305 TFLLELYPL 331 + + E+ P+ Sbjct: 134 SDIREMGPM 142 >XP_008371245.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Malus domestica] Length = 234 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +2 Query: 113 VLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 +L + L A+EIP++FRAFVD++DGYSYYYP DWR Sbjct: 69 LLHANSLFAQEIPEKFRAFVDKVDGYSYYYPNDWR 103 >XP_009335894.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic-like [Pyrus x bretschneideri] Length = 234 Score = 57.4 bits (137), Expect = 5e-07 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +2 Query: 113 VLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 +L + L A+EIP++FRAF+D++DGYSYYYP DWR Sbjct: 69 LLHANSLFAQEIPEKFRAFIDKVDGYSYYYPNDWR 103 >KFK36840.1 hypothetical protein AALP_AA4G178800 [Arabis alpina] Length = 237 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 128 LLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQIVMLVQ 304 LL+AEEIP + AFVDR DGYSYYYP+DWR F + + F Y L + + + Sbjct: 77 LLLAEEIPKNYSAFVDRQDGYSYYYPSDWREFDFRAHDSAFKDRYLQLQNVRVRFIPTEK 136 Query: 305 TFLLELYPL 331 T + E+ P+ Sbjct: 137 TDIREVGPM 145 >XP_009357670.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 205 Score = 56.6 bits (135), Expect = 7e-07 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +2 Query: 113 VLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 +L + + A+EIP++FRAF+D++DGYSYYYP DWR Sbjct: 40 LLHANSIFAQEIPEKFRAFIDKVDGYSYYYPNDWR 74 >XP_008233571.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Prunus mume] Length = 240 Score = 57.0 bits (136), Expect = 8e-07 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%) Frame = +2 Query: 113 VLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQI 289 +L + L AEEIP+++RAFVD+ DGYSYYYP DWR F + + F Y L + Sbjct: 75 LLQASSLFAEEIPEKYRAFVDKEDGYSYYYPYDWRDFEFRAHDSAFKDRYMQLHNVRVRF 134 Query: 290 VMLVQTFLLELYPL 331 + +T + EL P+ Sbjct: 135 LPTNKTDIHELGPM 148 >XP_009357671.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 240 Score = 56.6 bits (135), Expect = 1e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +2 Query: 113 VLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 +L + + A+EIP++FRAF+D++DGYSYYYP DWR Sbjct: 75 LLHANSIFAQEIPEKFRAFIDKVDGYSYYYPNDWR 109 >XP_018439492.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Raphanus sativus] XP_018439500.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Raphanus sativus] Length = 233 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 128 LLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQIVMLVQ 304 LL+AEE+P + AFVDR DGYSYYYP+DWR F + + F Y L + + + Sbjct: 73 LLLAEEVPKSYSAFVDREDGYSYYYPSDWREFDFRAHDSAFKDRYLQLQNVRVRFIPTEK 132 Query: 305 TFLLELYPL 331 T + E+ P+ Sbjct: 133 TDIREVGPM 141 >XP_011469842.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Fragaria vesca subsp. vesca] Length = 290 Score = 56.2 bits (134), Expect = 2e-06 Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 1/74 (1%) Frame = +2 Query: 113 VLLSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR-VPFISAEQGFFFEYSYLLYYHGQI 289 +L + L+AE IPD+FR +VD+ DGYSYYYP+DWR F + + F Y L + Sbjct: 125 LLHTSSLLAEGIPDKFRGYVDKEDGYSYYYPSDWRDFDFRAHDSAFKDRYMQLHNVRVRF 184 Query: 290 VMLVQTFLLELYPL 331 + +T + +L PL Sbjct: 185 IPTDKTDIHDLGPL 198 >XP_018836533.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Juglans regia] Length = 234 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/45 (60%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +2 Query: 86 LLFVRVCSYVLL-SGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 LL + + S L + L AEEIP +RAFVD DGYSYYYPADWR Sbjct: 59 LLKIGILSTTFLPASSLFAEEIPKNYRAFVDSADGYSYYYPADWR 103 >XP_004497306.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Cicer arietinum] Length = 234 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 122 SGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 + LL AEEIPDR+RAFVD DGYSY YP+DW+ Sbjct: 72 TNLLFAEEIPDRYRAFVDYSDGYSYVYPSDWK 103 >XP_010509010.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic [Camelina sativa] Length = 237 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 122 SGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 + LL+AEEIP + AFVDR DGYSYYYP+DWR Sbjct: 75 ASLLLAEEIPKSYSAFVDREDGYSYYYPSDWR 106 >XP_006294999.1 hypothetical protein CARUB_v10024070mg [Capsella rubella] EOA27897.1 hypothetical protein CARUB_v10024070mg [Capsella rubella] Length = 207 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 128 LLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 LL+AEEIP + AFVDR DGYSYYYP+DWR Sbjct: 76 LLLAEEIPKSYSAFVDREDGYSYYYPSDWR 105 >JAT47575.1 PsbP-like protein 2, chloroplastic [Anthurium amnicola] Length = 172 Score = 54.3 bits (129), Expect = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +2 Query: 119 LSGLLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 L + AEE+P+++ AFVD IDGYSYYYP+DWR Sbjct: 67 LPSITSAEEVPEKYNAFVDYIDGYSYYYPSDWR 99 >XP_010517301.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic-like isoform X2 [Camelina sativa] Length = 233 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 128 LLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 LL+AEEIP + AFVDR DGYSYYYP+DWR Sbjct: 73 LLLAEEIPKSYSAFVDREDGYSYYYPSDWR 102 >XP_010505625.1 PREDICTED: photosynthetic NDH subunit of lumenal location 1, chloroplastic isoform X2 [Camelina sativa] Length = 233 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 128 LLIAEEIPDRFRAFVDRIDGYSYYYPADWR 217 LL+AEEIP + AFVDR DGYSYYYP+DWR Sbjct: 73 LLLAEEIPKSYSAFVDREDGYSYYYPSDWR 102