BLASTX nr result
ID: Alisma22_contig00009137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00009137 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008796323.2 PREDICTED: diacylglycerol O-acyltransferase 2-lik... 57 9e-07 XP_010919928.2 PREDICTED: diacylglycerol O-acyltransferase 2 [El... 57 9e-07 >XP_008796323.2 PREDICTED: diacylglycerol O-acyltransferase 2-like [Phoenix dactylifera] Length = 311 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = -2 Query: 91 ARFIGKYVPGHFPVTVHIEDAKAFDQSKSY 2 AR++GKY PG+FPVTVH+EDA+AFDQ+K+Y Sbjct: 70 ARYVGKYAPGYFPVTVHMEDARAFDQNKAY 99 >XP_010919928.2 PREDICTED: diacylglycerol O-acyltransferase 2 [Elaeis guineensis] Length = 322 Score = 56.6 bits (135), Expect = 9e-07 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = -2 Query: 91 ARFIGKYVPGHFPVTVHIEDAKAFDQSKSY 2 AR++GKY PG+FPVTVH+EDA+AFDQ+K+Y Sbjct: 84 ARYVGKYAPGYFPVTVHMEDARAFDQNKAY 113