BLASTX nr result
ID: Alisma22_contig00008316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00008316 (700 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK68984.1 uncharacterized protein A4U43_C05F18070 [Asparagus of... 59 7e-08 ONK64148.1 uncharacterized protein A4U43_C07F22600 [Asparagus of... 56 7e-07 >ONK68984.1 uncharacterized protein A4U43_C05F18070 [Asparagus officinalis] Length = 119 Score = 59.3 bits (142), Expect = 7e-08 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +3 Query: 582 IGTKIVFVYYLCGNHHWKNPHFIEVTISSIEGLYLKGK 695 + KI VYYLC NHH ++PHFIEVT+SS EGLYL+G+ Sbjct: 26 VSRKIPVVYYLCRNHHLEHPHFIEVTVSSHEGLYLRGR 63 >ONK64148.1 uncharacterized protein A4U43_C07F22600 [Asparagus officinalis] Length = 108 Score = 56.2 bits (134), Expect = 7e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +3 Query: 582 IGTKIVFVYYLCGNHHWKNPHFIEVTISSIEGLYLKGK 695 + KI VYYLC N H ++PHFIEVT+SS EGLYL+G+ Sbjct: 26 VSRKIPVVYYLCRNRHLEHPHFIEVTVSSHEGLYLRGR 63