BLASTX nr result
ID: Alisma22_contig00008182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00008182 (1009 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT67352.1 Ferredoxin-thioredoxin reductase, variable chain, par... 101 4e-22 KMZ72814.1 Ferredoxin-thioredoxin reductase, variable chain [Zos... 95 6e-20 XP_009400294.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 93 3e-19 KZN05515.1 hypothetical protein DCAR_006352 [Daucus carota subsp... 93 5e-19 XP_010918464.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 92 6e-19 XP_017232469.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 93 8e-19 XP_008776379.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 91 1e-18 XP_010933312.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 91 2e-18 XP_008806674.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 90 3e-18 XP_017971310.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 89 8e-18 OEL14868.1 Ferredoxin-thioredoxin reductase, variable chain [Dic... 89 1e-17 XP_004489188.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 88 1e-17 XP_016538434.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 87 5e-17 P80680.1 RecName: Full=Ferredoxin-thioredoxin reductase, variabl... 85 6e-17 XP_016203950.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 87 7e-17 XP_017405545.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 86 8e-17 OAY32208.1 hypothetical protein MANES_14G174500 [Manihot esculenta] 85 8e-17 XP_008221385.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 86 1e-16 XP_014510317.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 86 1e-16 EOX98981.1 Ferredoxin/thioredoxin reductase subunit A 2 [Theobro... 86 1e-16 >JAT67352.1 Ferredoxin-thioredoxin reductase, variable chain, partial [Anthurium amnicola] Length = 198 Score = 101 bits (252), Expect = 4e-22 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = +2 Query: 5 VKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFFA 184 VKV HV K P LD+ +EG +KQYV LWKGKRISANLPFKVEFVLPDGVEG+PGP K A Sbjct: 126 VKVYHVQKAPGLDLEGMEGVIKQYVGLWKGKRISANLPFKVEFVLPDGVEGRPGPLKLVA 185 Query: 185 H 187 H Sbjct: 186 H 186 >KMZ72814.1 Ferredoxin-thioredoxin reductase, variable chain [Zostera marina] Length = 157 Score = 94.7 bits (234), Expect = 6e-20 Identities = 42/63 (66%), Positives = 51/63 (80%), Gaps = 1/63 (1%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEG-KPGPFKF 178 P+KV H+PKVPE ++ +EG VK YV++WKGK ISA PFKVEF+L DGVEG +PGP KF Sbjct: 83 PMKVFHIPKVPEFELEGMEGVVKDYVAVWKGKSISATFPFKVEFLLKDGVEGRRPGPLKF 142 Query: 179 FAH 187 FAH Sbjct: 143 FAH 145 >XP_009400294.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] XP_009400296.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] XP_009400297.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] XP_018682165.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] XP_018682166.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] Length = 163 Score = 93.2 bits (230), Expect = 3e-19 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HV K PELD+N LEG +KQYV +WKGKRISANLPFKVEF + VEG+P P KFF Sbjct: 91 PLKVYHVQKAPELDLNGLEGVIKQYVGVWKGKRISANLPFKVEFKI--DVEGQPRPVKFF 148 Query: 182 AH 187 AH Sbjct: 149 AH 150 >KZN05515.1 hypothetical protein DCAR_006352 [Daucus carota subsp. sativus] Length = 173 Score = 92.8 bits (229), Expect = 5e-19 Identities = 42/62 (67%), Positives = 52/62 (83%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVPKV E D+N LEG +KQ+V +WKGKRISANLPFKV+FV+ + +EG+ GP KFF Sbjct: 103 PLKVYHVPKVSEFDLNGLEGEIKQFVGVWKGKRISANLPFKVQFVV-EKIEGRDGPVKFF 161 Query: 182 AH 187 AH Sbjct: 162 AH 163 >XP_010918464.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Elaeis guineensis] Length = 156 Score = 92.0 bits (227), Expect = 6e-19 Identities = 43/62 (69%), Positives = 51/62 (82%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HV K PELD+N +EG +KQYV+LWKGKRISANLPFK+EF + VEG+P P KFF Sbjct: 87 PLKVYHVLKAPELDLNGMEGEIKQYVALWKGKRISANLPFKIEFHV--AVEGQPKPVKFF 144 Query: 182 AH 187 AH Sbjct: 145 AH 146 >XP_017232469.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Daucus carota subsp. sativus] Length = 197 Score = 92.8 bits (229), Expect = 8e-19 Identities = 42/62 (67%), Positives = 52/62 (83%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVPKV E D+N LEG +KQ+V +WKGKRISANLPFKV+FV+ + +EG+ GP KFF Sbjct: 127 PLKVYHVPKVSEFDLNGLEGEIKQFVGVWKGKRISANLPFKVQFVV-EKIEGRDGPVKFF 185 Query: 182 AH 187 AH Sbjct: 186 AH 187 >XP_008776379.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Phoenix dactylifera] XP_008778280.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Phoenix dactylifera] Length = 159 Score = 91.3 bits (225), Expect = 1e-18 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HV K PELD+N +EG +KQY+ LWKGKRISANLPFKVEF + VEG+P P KFF Sbjct: 82 PLKVYHVLKAPELDLNGMEGEIKQYLGLWKGKRISANLPFKVEFQV--AVEGQPKPVKFF 139 Query: 182 AH 187 AH Sbjct: 140 AH 141 >XP_010933312.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Elaeis guineensis] Length = 162 Score = 90.9 bits (224), Expect = 2e-18 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HV K PELD+N +EG +KQYV LWKGKRISANLPFKVEF + V+G+P P KFF Sbjct: 90 PLKVYHVLKAPELDLNGMEGEIKQYVGLWKGKRISANLPFKVEFHV--AVDGQPKPVKFF 147 Query: 182 AH 187 AH Sbjct: 148 AH 149 >XP_008806674.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Phoenix dactylifera] Length = 163 Score = 90.1 bits (222), Expect = 3e-18 Identities = 43/62 (69%), Positives = 50/62 (80%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HV K PELD+ +EG +KQYV+LWKGKRISANLPFKVEF + VEG+P P KFF Sbjct: 91 PLKVYHVLKAPELDLEGMEGEIKQYVALWKGKRISANLPFKVEFHV--AVEGQPKPVKFF 148 Query: 182 AH 187 AH Sbjct: 149 AH 150 >XP_017971310.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Theobroma cacao] Length = 168 Score = 89.4 bits (220), Expect = 8e-18 Identities = 42/62 (67%), Positives = 52/62 (83%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVP+VPE+D+ +EG +KQYV+LWKGKRISANLP+KVEFV +EG+ GP KFF Sbjct: 100 PLKVYHVPRVPEVDLTGMEGVIKQYVALWKGKRISANLPYKVEFV--KEIEGR-GPVKFF 156 Query: 182 AH 187 AH Sbjct: 157 AH 158 >OEL14868.1 Ferredoxin-thioredoxin reductase, variable chain [Dichanthelium oligosanthes] Length = 154 Score = 88.6 bits (218), Expect = 1e-17 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P++V HV KVP+LDI +EG VKQYV +WKGKRI+ANLPFKVEF L VEG+P P KFF Sbjct: 83 PLRVYHVVKVPDLDIQGMEGVVKQYVGVWKGKRITANLPFKVEFQL--AVEGQPKPVKFF 140 Query: 182 AH 187 H Sbjct: 141 VH 142 >XP_004489188.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cicer arietinum] Length = 129 Score = 87.8 bits (216), Expect = 1e-17 Identities = 40/62 (64%), Positives = 50/62 (80%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVPKVPE+D+ +EG +KQ V+LWKGKRISANLP+KVEF+ D ++G GP KF Sbjct: 60 PLKVYHVPKVPEIDLAGMEGNIKQNVALWKGKRISANLPYKVEFISKD-IQGPRGPLKFS 118 Query: 182 AH 187 AH Sbjct: 119 AH 120 >XP_016538434.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Capsicum annuum] Length = 154 Score = 86.7 bits (213), Expect = 5e-17 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 PVKV HVPKVPELD+N GT+KQYV+++KGK+ISAN P+KVEFV+ D +EG+ P KF Sbjct: 84 PVKVYHVPKVPELDLNGRIGTLKQYVAIYKGKQISANFPYKVEFVV-DNLEGRSAPVKFA 142 Query: 182 AH 187 AH Sbjct: 143 AH 144 >P80680.1 RecName: Full=Ferredoxin-thioredoxin reductase, variable chain; Short=FTR-V; AltName: Full=Ferredoxin-thioredoxin reductase subunit A; Short=FTR-A Length = 97 Score = 84.7 bits (208), Expect = 6e-17 Identities = 39/62 (62%), Positives = 48/62 (77%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P++V HV K P+LDI +EG VKQYV +WKGKR++AN PFKVEF L VEG+P P +FF Sbjct: 27 PLRVYHVLKAPDLDIQGMEGVVKQYVCVWKGKRVTANFPFKVEFEL--AVEGQPKPVRFF 84 Query: 182 AH 187 AH Sbjct: 85 AH 86 >XP_016203950.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Arachis ipaensis] Length = 164 Score = 86.7 bits (213), Expect = 7e-17 Identities = 42/62 (67%), Positives = 50/62 (80%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVPKVPELD++ +EG +KQYV LW GKRISANLP+KVEFV +EG+ G KFF Sbjct: 97 PLKVYHVPKVPELDLDGMEGQIKQYVGLWNGKRISANLPYKVEFVTE--IEGR-GKVKFF 153 Query: 182 AH 187 AH Sbjct: 154 AH 155 >XP_017405545.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Vigna angularis] KOM25362.1 hypothetical protein LR48_Vigan102s002000 [Vigna angularis] Length = 142 Score = 85.9 bits (211), Expect = 8e-17 Identities = 42/61 (68%), Positives = 49/61 (80%) Frame = +2 Query: 5 VKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFFA 184 VKV HVPKVPELD+ +EG +KQYV LW GKRISANLP+KV+FV V+G+ GP KFFA Sbjct: 76 VKVYHVPKVPELDLTGMEGEIKQYVGLWNGKRISANLPYKVQFV--TDVQGR-GPVKFFA 132 Query: 185 H 187 H Sbjct: 133 H 133 >OAY32208.1 hypothetical protein MANES_14G174500 [Manihot esculenta] Length = 109 Score = 84.7 bits (208), Expect = 8e-17 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVP+VPE+D+ EG +KQYV+LWKGKRISANLP+KVEFV+ +EG+ P KFF Sbjct: 41 PLKVFHVPRVPEVDLTGKEGQLKQYVALWKGKRISANLPYKVEFVV--DIEGR-CPIKFF 97 Query: 182 AH 187 AH Sbjct: 98 AH 99 >XP_008221385.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like, partial [Prunus mume] Length = 139 Score = 85.5 bits (210), Expect = 1e-16 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVP+VPEL+I +EG +KQYV LWKGKRISANLP+KV+FV+ VEG+ G KFF Sbjct: 72 PLKVYHVPRVPELEITGMEGELKQYVGLWKGKRISANLPYKVQFVV--DVEGR-GAVKFF 128 Query: 182 AH 187 AH Sbjct: 129 AH 130 >XP_014510317.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Vigna radiata var. radiata] Length = 153 Score = 85.9 bits (211), Expect = 1e-16 Identities = 42/61 (68%), Positives = 49/61 (80%) Frame = +2 Query: 5 VKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFFA 184 VKV HVPKVPELD+ +EG +KQYV LW GKRISANLP+KV+FV V+G+ GP KFFA Sbjct: 87 VKVYHVPKVPELDLTGMEGEIKQYVGLWNGKRISANLPYKVQFV--TDVQGR-GPVKFFA 143 Query: 185 H 187 H Sbjct: 144 H 144 >EOX98981.1 Ferredoxin/thioredoxin reductase subunit A 2 [Theobroma cacao] Length = 168 Score = 86.3 bits (212), Expect = 1e-16 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = +2 Query: 2 PVKVCHVPKVPELDINALEGTVKQYVSLWKGKRISANLPFKVEFVLPDGVEGKPGPFKFF 181 P+KV HVP+V E+D+ +EG +KQYV+LWKGKRISANLP+KVEFV +EG+ GP KFF Sbjct: 100 PLKVYHVPRVQEVDLTGMEGVIKQYVALWKGKRISANLPYKVEFV--KEIEGR-GPVKFF 156 Query: 182 AH 187 AH Sbjct: 157 AH 158