BLASTX nr result
ID: Alisma22_contig00008062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00008062 (856 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007226509.1 hypothetical protein PRUPE_ppa025864mg [Prunus pe... 60 2e-06 >XP_007226509.1 hypothetical protein PRUPE_ppa025864mg [Prunus persica] Length = 838 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = -3 Query: 383 PGYPPERDVDFEIQILPSGHSIEIITDRMAP*ISPMLFEKKKE*TMLLCID*RQLNKIT 207 PG PPER+++F I+++P I +P +P+LF KKK+ TM LCID RQLNK+T Sbjct: 207 PGLPPEREIEFTIELVPKLVDKGFIRPSFSPWGAPILFVKKKDGTMKLCIDYRQLNKVT 265