BLASTX nr result
ID: Alisma22_contig00007424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00007424 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP50397.1 Retrovirus-related Pol polyprotein from transposon TN... 72 6e-14 KYP45103.1 Retrovirus-related Pol polyprotein from transposon TN... 73 3e-13 KYP65446.1 Retrovirus-related Pol polyprotein from transposon TN... 71 1e-12 KYP54535.1 Retrovirus-related Pol polyprotein from transposon TN... 72 1e-12 KYP71533.1 Retrovirus-related Pol polyprotein from transposon TN... 70 1e-12 KYP54541.1 Retrovirus-related Pol polyprotein from transposon TN... 72 2e-12 KYP54537.1 Retrovirus-related Pol polyprotein from transposon TN... 72 2e-12 KYP34729.1 Retrovirus-related Pol polyprotein from transposon TN... 71 4e-12 KYP58728.1 Retrovirus-related Pol polyprotein from transposon TN... 71 4e-12 KYP37063.1 Retrovirus-related Pol polyprotein from transposon TN... 68 4e-12 KYP40247.1 Retrovirus-related Pol polyprotein from transposon TN... 70 8e-12 KYP31378.1 Retrovirus-related Pol polyprotein from transposon TN... 70 9e-12 KYP76032.1 Retrovirus-related Pol polyprotein from transposon TN... 70 9e-12 KYP74314.1 Retrovirus-related Pol polyprotein from transposon TN... 69 1e-11 KYP42175.1 Retrovirus-related Pol polyprotein from transposon TN... 69 1e-11 KYP75541.1 Retrovirus-related Pol polyprotein from transposon TN... 69 2e-11 KYP67096.1 Retrovirus-related Pol polyprotein from transposon TN... 69 2e-11 CAN76196.1 hypothetical protein VITISV_041073 [Vitis vinifera] 69 2e-11 KYP62840.1 Retrovirus-related Pol polyprotein from transposon TN... 66 2e-11 XP_019085460.1 PREDICTED: uncharacterized protein LOC109126393 [... 69 2e-11 >KYP50397.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 139 Score = 72.0 bits (175), Expect = 6e-14 Identities = 34/74 (45%), Positives = 49/74 (66%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHKNLRA----VFDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F K++ + FD++H DVW Sbjct: 22 HRRLGHPSLNKLKKMVPHLSRLESLECESCQLGKHVRTSFPKSINSRVVSPFDVIHSDVW 81 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 82 GPSRVPSLLGHRYY 95 >KYP45103.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 326 Score = 73.2 bits (178), Expect = 3e-13 Identities = 37/74 (50%), Positives = 51/74 (68%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHKNL--RAV--FDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F K++ RAV FD++H DVW Sbjct: 193 HRRLGHPSLNKLKKMVPHLSRLESLECESCQLGKHVRTSFPKSIKSRAVSPFDVIHSDVW 252 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 253 GPSRVPSLLGHRYY 266 >KYP65446.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 273 Score = 71.2 bits (173), Expect = 1e-12 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 8/78 (10%) Frame = +3 Query: 96 WHFRLGHPSAEK---LKHVISGVR-SHSFQCEACQLGKQSRSVF----HKNLRAVFDLVH 251 WH+RLGHPS E+ LKH + +F C+ C KQ R F K++ A FDL+H Sbjct: 186 WHYRLGHPSIERMQILKHSFPSIDFDRNFVCDTCHYAKQKRISFPNSDSKSVSA-FDLIH 244 Query: 252 VDVWGPCHIPSLSDNKYF 305 VD+WGPC++ S+ +KYF Sbjct: 245 VDIWGPCNVSSMHGHKYF 262 >KYP54535.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 342 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 7/77 (9%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVISGVRS----HSFQCEACQLGKQSRSVF---HKNLRAVFDLVHV 254 WHFR GHPS+E+L+ + + +F CE C KQ R F + + F+L+HV Sbjct: 192 WHFRFGHPSSERLQALKQTYPAIDFDKNFVCETCHRAKQKRFSFPNSESHSSSPFNLIHV 251 Query: 255 DVWGPCHIPSLSDNKYF 305 D+WGPC+IPS+ +KYF Sbjct: 252 DIWGPCNIPSMQGHKYF 268 >KYP71533.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 191 Score = 69.7 bits (169), Expect = 1e-12 Identities = 33/74 (44%), Positives = 49/74 (66%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHKNLR----AVFDLVHVDVW 263 H LGHPS KLK +++ + R S +CE+CQLGK R+ F ++ + FD++H DVW Sbjct: 1 HRHLGHPSLNKLKKMVTHLSRLESLECESCQLGKHVRASFPNSINNRAMSPFDVIHFDVW 60 Query: 264 GPCHIPSLSDNKYF 305 GP +PSLS ++Y+ Sbjct: 61 GPNCVPSLSGHRYY 74 >KYP54541.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 640 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 7/77 (9%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVISGVRS----HSFQCEACQLGKQSRSVF---HKNLRAVFDLVHV 254 WHFR GHPS+E+L+ + + +F CE C KQ R F + + F+L+HV Sbjct: 490 WHFRFGHPSSERLQALKQTYPAIDFDKNFVCETCHRAKQKRFSFPNSESHSSSPFNLIHV 549 Query: 255 DVWGPCHIPSLSDNKYF 305 D+WGPC+IPS+ +KYF Sbjct: 550 DIWGPCNIPSMQGHKYF 566 >KYP54537.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 660 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 7/77 (9%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVISGVRS----HSFQCEACQLGKQSRSVF---HKNLRAVFDLVHV 254 WHFR GHPS+E+L+ + + +F CE C KQ R F + + F+L+HV Sbjct: 510 WHFRFGHPSSERLQALKQTYPAIDFDKNFVCETCHRAKQKRFSFPNSESHSSSPFNLIHV 569 Query: 255 DVWGPCHIPSLSDNKYF 305 D+WGPC+IPS+ +KYF Sbjct: 570 DIWGPCNIPSMQGHKYF 586 >KYP34729.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1180 Score = 70.9 bits (172), Expect = 4e-12 Identities = 33/74 (44%), Positives = 49/74 (66%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHKNLRA----VFDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F ++ + +FD++H DVW Sbjct: 267 HRRLGHPSLNKLKKMVPHLSRLESLECESCQLGKHVRASFPNSVNSRAMCLFDVIHSDVW 326 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 327 GPSRVPSLLGHRYY 340 >KYP58728.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1402 Score = 70.9 bits (172), Expect = 4e-12 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHK--NLRAV--FDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F N RA+ FD++H DVW Sbjct: 472 HRRLGHPSLNKLKKMVPHLSRLESLECESCQLGKHVRASFPNSINSRAMSPFDVIHSDVW 531 Query: 264 GPCHIPSLSDNKYF 305 GP IPSL ++Y+ Sbjct: 532 GPSRIPSLLGHRYY 545 >KYP37063.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 175 Score = 68.2 bits (165), Expect = 4e-12 Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHKNLRA----VFDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F ++ + FD++H DVW Sbjct: 91 HRRLGHPSLNKLKKMVPHLSRLESLECESCQLGKHVRTSFPNSINSRVVSPFDVIHSDVW 150 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 151 GPNCVPSLLGHRYY 164 >KYP40247.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 385 Score = 69.7 bits (169), Expect = 8e-12 Identities = 36/74 (48%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGVRS-HSFQCEACQLGKQSRSVFHK--NLRAV--FDLVHVDVW 263 H RLGHPS KLK ++ + S +CE+CQLGK R+ F N RAV FD++H DVW Sbjct: 193 HRRLGHPSLNKLKKMVPHLSCLESLECESCQLGKHVRTSFPNSINSRAVSPFDVIHSDVW 252 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 253 GPSRVPSLLGHRYY 266 >KYP31378.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 585 Score = 69.7 bits (169), Expect = 9e-12 Identities = 35/74 (47%), Positives = 45/74 (60%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGVRSHS-FQCEACQLGKQSRSVF----HKNLRAVFDLVHVDVW 263 H +LGHPS KL+H++ + S CE+CQLGK SRS F HK + F LVH D+W Sbjct: 466 HAQLGHPSLAKLQHLVPRLSKLSQLSCESCQLGKHSRSSFSPSVHKQASSPFALVHSDIW 525 Query: 264 GPCHIPSLSDNKYF 305 GP +PS +YF Sbjct: 526 GPSRVPSTLGFQYF 539 >KYP76032.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1355 Score = 69.7 bits (169), Expect = 9e-12 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHK--NLRAV--FDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F N RA+ FD++H DVW Sbjct: 425 HRRLGHPSLNKLKKMVPHLSRLVSLECESCQLGKHVRASFPNSINSRAMSPFDVIHSDVW 484 Query: 264 GPCHIPSLSDNKYF 305 GP IPSL ++Y+ Sbjct: 485 GPSRIPSLLGHRYY 498 >KYP74314.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1275 Score = 69.3 bits (168), Expect = 1e-11 Identities = 36/74 (48%), Positives = 49/74 (66%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHK--NLRAV--FDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F N RA+ FD++H DVW Sbjct: 472 HRRLGHPSLNKLKKMVPHLSRLVSLECESCQLGKHVRASFPNSINSRAMSPFDVIHSDVW 531 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 532 GPSRVPSLLGHRYY 545 >KYP42175.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 304 Score = 68.6 bits (166), Expect = 1e-11 Identities = 37/74 (50%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHK--NLRAV--FDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F K N RAV FD++H DVW Sbjct: 129 HRRLGHPSLNKLKKMVPHLSRLESLECESCQLGKHVRTSFPKSINSRAVSPFDVIHSDVW 188 Query: 264 GPCHIPSLSDNKYF 305 G +PSL +Y+ Sbjct: 189 GLSRVPSLLGYRYY 202 >KYP75541.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 568 Score = 68.9 bits (167), Expect = 2e-11 Identities = 35/74 (47%), Positives = 50/74 (67%), Gaps = 5/74 (6%) Frame = +3 Query: 99 HFRLGHPSAEKLKHVISGV-RSHSFQCEACQLGKQSRSVFHKNL--RAV--FDLVHVDVW 263 H RLGHPS KLK ++ + R S +CE+CQLGK R+ F ++ RAV FD++H +VW Sbjct: 35 HCRLGHPSLNKLKKMVPYLSRLESLKCESCQLGKHVRTSFPNSINNRAVSPFDVIHSNVW 94 Query: 264 GPCHIPSLSDNKYF 305 GP +PSL ++Y+ Sbjct: 95 GPSRVPSLLGHRYY 108 >KYP67096.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 850 Score = 68.9 bits (167), Expect = 2e-11 Identities = 35/78 (44%), Positives = 44/78 (56%), Gaps = 8/78 (10%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVISGVRSHSFQ-----CEACQLGKQSRSVFHKNLRA---VFDLVH 251 WH RLGHPS EKL ++ + F CE C L KQ R F + VFDL+H Sbjct: 21 WHLRLGHPSHEKLGNIQTMYPFVKFNKDKVPCEVCHLAKQKRLPFAYSSNTCDNVFDLIH 80 Query: 252 VDVWGPCHIPSLSDNKYF 305 +D+WGP IPS+ +KYF Sbjct: 81 IDIWGPLSIPSIFGHKYF 98 >CAN76196.1 hypothetical protein VITISV_041073 [Vitis vinifera] Length = 1505 Score = 68.9 bits (167), Expect = 2e-11 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 7/77 (9%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVISGV----RSHSFQCEACQLGKQSRSVFHKN---LRAVFDLVHV 254 WH+RLGHPS + LKH+ + SFQCE C+L K R+ F + F L+H Sbjct: 497 WHYRLGHPSFQYLKHLFPSLFRNKNPSSFQCEFCELAKHHRTSFPLQPYRISKPFSLIHS 556 Query: 255 DVWGPCHIPSLSDNKYF 305 DVWGP I +LS K+F Sbjct: 557 DVWGPSRISTLSGKKWF 573 >KYP62840.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 175 Score = 66.2 bits (160), Expect = 2e-11 Identities = 33/77 (42%), Positives = 45/77 (58%), Gaps = 7/77 (9%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVISGVRS----HSFQCEACQLGKQSRSVF-HKNLRAV--FDLVHV 254 WH+RLGHPS ++L + S F CE C L KQ + F H + ++ F LVHV Sbjct: 77 WHYRLGHPSVDRLHMLKQSYPSITVDKQFVCETCHLAKQKKISFPHSDSHSLTTFALVHV 136 Query: 255 DVWGPCHIPSLSDNKYF 305 D+WGPC I S+ ++YF Sbjct: 137 DIWGPCAITSMHGHRYF 153 >XP_019085460.1 PREDICTED: uncharacterized protein LOC109126393 [Camelina sativa] Length = 981 Score = 68.6 bits (166), Expect = 2e-11 Identities = 35/77 (45%), Positives = 43/77 (55%), Gaps = 7/77 (9%) Frame = +3 Query: 96 WHFRLGHPSAEKLKHVIS----GVRSHSFQCEACQLGKQSRSVFHKN---LRAVFDLVHV 254 WH RLGHPS++KLKHV S S C C L KQ R F + A FDL+H+ Sbjct: 606 WHQRLGHPSSDKLKHVPSISSLSTLSSESPCSICHLAKQKRLPFESSGHRSSAPFDLIHL 665 Query: 255 DVWGPCHIPSLSDNKYF 305 D+WGP + S+ KYF Sbjct: 666 DIWGPFAVESIDGFKYF 682