BLASTX nr result
ID: Alisma22_contig00006711
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00006711 (1629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT49928.1 hypothetical protein g.60009, partial [Anthurium amni... 76 6e-12 JAT62880.1 hypothetical protein g.45628, partial [Anthurium amni... 62 3e-07 >JAT49928.1 hypothetical protein g.60009, partial [Anthurium amnicola] Length = 249 Score = 76.3 bits (186), Expect = 6e-12 Identities = 35/74 (47%), Positives = 48/74 (64%) Frame = -3 Query: 784 RKKKKVEMWISLSRDEIEEDYYSITGAKLXXXXXXXXRTAVHPTVLNRIFPGSWLPNTVT 605 R+K++VE+W+SLSR+EIEED+ +TGAK AV + +FPGSWLP+ +T Sbjct: 175 RRKRRVELWVSLSREEIEEDFLWMTGAKPPPRRSRRRARAVSDHLKQGVFPGSWLPSKIT 234 Query: 604 LEMYRVHEPIDQRK 563 Y+V EP D RK Sbjct: 235 ANRYKVSEPADSRK 248 >JAT62880.1 hypothetical protein g.45628, partial [Anthurium amnicola] Length = 250 Score = 62.4 bits (150), Expect = 3e-07 Identities = 30/79 (37%), Positives = 48/79 (60%) Frame = -3 Query: 799 GANGLRKKKKVEMWISLSRDEIEEDYYSITGAKLXXXXXXXXRTAVHPTVLNRIFPGSWL 620 G +K++VE+W+ LS+ EI+ED+ +TG+K R +L+ IFPGSWL Sbjct: 173 GEEKAERKRRVELWVPLSKAEIDEDFLRMTGSK--PPRKCRRRARAESYLLDGIFPGSWL 230 Query: 619 PNTVTLEMYRVHEPIDQRK 563 PN ++ + Y+V +P + RK Sbjct: 231 PNMISTDRYKVCDPSNPRK 249