BLASTX nr result
ID: Alisma22_contig00006504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00006504 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK81305.1 uncharacterized protein A4U43_C01F27630 [Asparagus of... 56 5e-07 ONK81308.1 uncharacterized protein A4U43_C01F27660 [Asparagus of... 52 5e-06 >ONK81305.1 uncharacterized protein A4U43_C01F27630 [Asparagus officinalis] Length = 178 Score = 56.2 bits (134), Expect = 5e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 424 LMGDGEEAEARRQRVKELGAAARRAVMEDGSSSRDIDVLIEEL 296 +MGD EEAE RR+R +ELG AA+RAV E GSS D+D LI+EL Sbjct: 132 VMGDDEEAEERRERARELGEAAKRAVDEGGSSYSDLDSLIQEL 174 >ONK81308.1 uncharacterized protein A4U43_C01F27660 [Asparagus officinalis] Length = 103 Score = 52.0 bits (123), Expect = 5e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 424 LMGDGEEAEARRQRVKELGAAARRAVMEDGSSSRDIDVLIEELR 293 LMG+GEEAE RR++ KELG A++AV E+GSS + LIEEL+ Sbjct: 53 LMGEGEEAEERRRKAKELGEKAKKAVDEEGSSYVGLSNLIEELK 96