BLASTX nr result
ID: Alisma22_contig00006077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00006077 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP50397.1 Retrovirus-related Pol polyprotein from transposon TN... 73 4e-14 KYP53389.1 Two pore calcium channel protein 1 [Cajanus cajan] 73 6e-14 KYP52605.1 Retrovirus-related Pol polyprotein from transposon TN... 73 6e-14 KYP51688.1 Retrovirus-related Pol polyprotein from transposon TN... 73 9e-14 KYP32657.1 Retrovirus-related Pol polyprotein from transposon TN... 73 3e-13 XP_019188788.1 PREDICTED: uncharacterized protein LOC109183026 [... 75 3e-13 KYP68424.1 Retrovirus-related Pol polyprotein from transposon TN... 73 4e-13 KYP45103.1 Retrovirus-related Pol polyprotein from transposon TN... 74 5e-13 KYP49284.1 Retrovirus-related Pol polyprotein from transposon TN... 73 6e-13 KYP42217.1 Retrovirus-related Pol polyprotein from transposon TN... 71 7e-13 KYP34729.1 Retrovirus-related Pol polyprotein from transposon TN... 74 8e-13 XP_018716005.1 PREDICTED: uncharacterized protein LOC108954459 [... 68 1e-12 CAN78715.1 hypothetical protein VITISV_030863 [Vitis vinifera] 73 1e-12 CAN75744.1 hypothetical protein VITISV_040125 [Vitis vinifera] 73 1e-12 KYP74314.1 Retrovirus-related Pol polyprotein from transposon TN... 73 1e-12 KYP40247.1 Retrovirus-related Pol polyprotein from transposon TN... 72 2e-12 KYP40190.1 Retrovirus-related Pol polyprotein from transposon TN... 72 2e-12 CAN65932.1 hypothetical protein VITISV_016257 [Vitis vinifera] 72 2e-12 KYP76032.1 Retrovirus-related Pol polyprotein from transposon TN... 72 2e-12 KYP58728.1 Retrovirus-related Pol polyprotein from transposon TN... 72 2e-12 >KYP50397.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 139 Score = 73.2 bits (178), Expect = 4e-14 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +PK + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 61 FPKSINSRVVSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 111 >KYP53389.1 Two pore calcium channel protein 1 [Cajanus cajan] Length = 144 Score = 72.8 bits (177), Expect = 6e-14 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +PK + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F++ Sbjct: 26 FPKSINSRAVSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLI 76 >KYP52605.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 160 Score = 73.2 bits (178), Expect = 6e-14 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +PK + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 26 FPKSINSRVVSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 76 >KYP51688.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 160 Score = 72.8 bits (177), Expect = 9e-14 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 26 FPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 76 >KYP32657.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 217 Score = 72.8 bits (177), Expect = 3e-13 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 26 FPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 76 >XP_019188788.1 PREDICTED: uncharacterized protein LOC109183026 [Ipomoea nil] Length = 428 Score = 74.7 bits (182), Expect = 3e-13 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 YP R + ++F LVHSDVWGPC VPS S KYF+ F+DDFSR TWL++M Sbjct: 169 YPPRVNKRVDSLFQLVHSDVWGPCRVPSKSEFKYFVTFVDDFSRHTWLYLM 219 >KYP68424.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 245 Score = 72.8 bits (177), Expect = 4e-13 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 26 FPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 76 >KYP45103.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 326 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +PK + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 232 FPKSIKSRAVSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 282 >KYP49284.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 284 Score = 72.8 bits (177), Expect = 6e-13 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 26 FPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 76 >KYP42217.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] KYP42227.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 179 Score = 70.9 bits (172), Expect = 7e-13 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + D++HSDVWGP VPSL GHKY++ FIDDFSR TW+F+M Sbjct: 26 FPNSINSRAMSPCDVIHSDVWGPSRVPSLLGHKYYVTFIDDFSRCTWIFLM 76 >KYP34729.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1180 Score = 73.6 bits (179), Expect = 8e-13 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + +FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 306 FPNSVNSRAMCLFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 356 >XP_018716005.1 PREDICTED: uncharacterized protein LOC108954459 [Eucalyptus grandis] Length = 878 Score = 67.8 bits (164), Expect(2) = 1e-12 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 146 RTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 ++H+SS F+LVHSDVWGPC V + KYF++F+DDFSR TWLF++ Sbjct: 640 QSHVSSP--FELVHSDVWGPCRVSDVFRFKYFVIFVDDFSRMTWLFLI 685 Score = 32.0 bits (71), Expect(2) = 1e-12 Identities = 21/53 (39%), Positives = 25/53 (47%) Frame = -3 Query: 358 QDLRTRMKIGGGYEGPDGLFYLDHLPKADRXXXXXXXXXXXXXLQWHYRLGHP 200 +DLRT IGGG+E +GL+YLD A Q H R GHP Sbjct: 555 KDLRTGQMIGGGHES-NGLYYLDKKVLA----TATVKQTSTYVYQMHCRAGHP 602 >CAN78715.1 hypothetical protein VITISV_030863 [Vitis vinifera] Length = 1228 Score = 72.8 bits (177), Expect = 1e-12 Identities = 36/87 (41%), Positives = 50/87 (57%) Frame = -2 Query: 263 CGFCTIYISFSSTVALPTWASVF*KAPXXXXXXXXXYPKRTHISSKNIFDLVHSDVWGPC 84 C F I IS T +S+ ++ +PKR + +K+ F+LVH+DVWGPC Sbjct: 356 CPFNLISISKKMVPRFSTLSSLPCESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPC 415 Query: 83 HVPSLSGHKYFILFIDDFSRTTWLFMM 3 S G +YF+ FIDD+SR TWLF+M Sbjct: 416 RTASTLGFQYFVTFIDDYSRCTWLFLM 442 >CAN75744.1 hypothetical protein VITISV_040125 [Vitis vinifera] Length = 1257 Score = 72.8 bits (177), Expect = 1e-12 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +PKR + +K+ F+LVH+DVWGPC S G +YF+ FIDD+SR TWLF+M Sbjct: 480 FPKRLNNRAKSXFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLM 530 >KYP74314.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1275 Score = 72.8 bits (177), Expect = 1e-12 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 511 FPNSINSRAMSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 561 >KYP40247.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 385 Score = 72.4 bits (176), Expect = 2e-12 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP VPSL GH+Y++ FIDDFSR TW+F+M Sbjct: 232 FPNSINSRAVSPFDVIHSDVWGPSRVPSLLGHRYYVTFIDDFSRCTWIFLM 282 >KYP40190.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 478 Score = 72.4 bits (176), Expect = 2e-12 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP +PSL GH+Y++ FIDDFSR TW+F+M Sbjct: 26 FPNSINSRAMSPFDVIHSDVWGPSRIPSLLGHRYYVTFIDDFSRCTWIFLM 76 >CAN65932.1 hypothetical protein VITISV_016257 [Vitis vinifera] Length = 498 Score = 72.4 bits (176), Expect = 2e-12 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +PKR + +K+ F+LVH+DVWGPC S G +YF+ FIDD+SR TWLF+M Sbjct: 446 FPKRLNNRAKSSFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLFLM 496 >KYP76032.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1355 Score = 72.4 bits (176), Expect = 2e-12 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP +PSL GH+Y++ FIDDFSR TW+F+M Sbjct: 464 FPNSINSRAMSPFDVIHSDVWGPSRIPSLLGHRYYVTFIDDFSRCTWIFLM 514 >KYP58728.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1402 Score = 72.4 bits (176), Expect = 2e-12 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = -2 Query: 155 YPKRTHISSKNIFDLVHSDVWGPCHVPSLSGHKYFILFIDDFSRTTWLFMM 3 +P + + + FD++HSDVWGP +PSL GH+Y++ FIDDFSR TW+F+M Sbjct: 511 FPNSINSRAMSPFDVIHSDVWGPSRIPSLLGHRYYVTFIDDFSRCTWIFLM 561