BLASTX nr result
ID: Alisma22_contig00005827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00005827 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010921474.1 PREDICTED: beta-carotene isomerase D27, chloropla... 52 8e-06 >XP_010921474.1 PREDICTED: beta-carotene isomerase D27, chloroplastic [Elaeis guineensis] Length = 265 Score = 52.0 bits (123), Expect = 8e-06 Identities = 29/65 (44%), Positives = 37/65 (56%), Gaps = 6/65 (9%) Frame = +3 Query: 93 LVLCPSFPVQPRRVFQN-----SGTRFRCSQYPAQSVA-DGPKTEYKPGPFDDLFMAFFR 254 ++ PS PV R + RFR + P +S A D PK+EYKPG FDDL + +FR Sbjct: 6 ILRAPSLPVSSRSPLERHDRSGGNRRFRVACSPVRSQAIDTPKSEYKPGIFDDLLLVYFR 65 Query: 255 SKMVE 269 KMVE Sbjct: 66 KKMVE 70