BLASTX nr result
ID: Alisma22_contig00005552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00005552 (490 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244879.1 PREDICTED: nudix hydrolase 21, chloroplastic-like... 57 3e-07 XP_015883783.1 PREDICTED: nudix hydrolase 18, mitochondrial-like... 57 8e-07 ONK65316.1 uncharacterized protein A4U43_C07F35870 [Asparagus of... 56 1e-06 XP_011085849.1 PREDICTED: nudix hydrolase 18, mitochondrial-like... 55 2e-06 KZM98472.1 hypothetical protein DCAR_014166 [Daucus carota subsp... 55 2e-06 XP_008803888.1 PREDICTED: nudix hydrolase 17, mitochondrial-like... 55 2e-06 XP_004140308.1 PREDICTED: nudix hydrolase 18, mitochondrial [Cuc... 55 2e-06 XP_018816555.1 PREDICTED: nudix hydrolase 17, mitochondrial-like... 55 3e-06 XP_017636177.1 PREDICTED: nudix hydrolase 18, mitochondrial-like... 54 7e-06 XP_020099712.1 nudix hydrolase 17, mitochondrial [Ananas comosus] 53 9e-06 >XP_017244879.1 PREDICTED: nudix hydrolase 21, chloroplastic-like [Daucus carota subsp. sativus] Length = 174 Score = 57.4 bits (137), Expect = 3e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 327 NMVTMVSRQGRHLQRYTTQGRRRIVGCIPYR 419 NMV+MV+R GRHLQRY+T GRR++VGCIPYR Sbjct: 14 NMVSMVARNGRHLQRYSTLGRRQVVGCIPYR 44 >XP_015883783.1 PREDICTED: nudix hydrolase 18, mitochondrial-like [Ziziphus jujuba] XP_015902169.1 PREDICTED: nudix hydrolase 18, mitochondrial-like [Ziziphus jujuba] Length = 207 Score = 56.6 bits (135), Expect = 8e-07 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 321 YANMVTMVSRQGRHLQRYTTQGRRRIVGCIPYRLTH 428 + NMV++VSR+GRHLQRY +G R++VGCIPYR H Sbjct: 32 FENMVSLVSRKGRHLQRYDNKGCRQVVGCIPYRFRH 67 >ONK65316.1 uncharacterized protein A4U43_C07F35870 [Asparagus officinalis] Length = 175 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +3 Query: 330 MVTMVSRQGRHLQRYTTQGRRRIVGCIPYRLTHNNNYRLPISDN 461 MV +VSRQGR LQRY+ GRR +VGCIPY+L NN + +N Sbjct: 1 MVALVSRQGRQLQRYSDSGRRLVVGCIPYKLNINNQCNSDLIEN 44 >XP_011085849.1 PREDICTED: nudix hydrolase 18, mitochondrial-like [Sesamum indicum] Length = 180 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +3 Query: 327 NMVTMVSRQGRHLQRYTTQGRRRIVGCIPYRLTHN 431 NMVT+VSR GRHLQRY G R++VGCIPYR N Sbjct: 5 NMVTLVSRTGRHLQRYNFHGHRQVVGCIPYRYKSN 39 >KZM98472.1 hypothetical protein DCAR_014166 [Daucus carota subsp. sativus] Length = 166 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 330 MVTMVSRQGRHLQRYTTQGRRRIVGCIPYR 419 MV+MV+R GRHLQRY+T GRR++VGCIPYR Sbjct: 1 MVSMVARNGRHLQRYSTLGRRQVVGCIPYR 30 >XP_008803888.1 PREDICTED: nudix hydrolase 17, mitochondrial-like [Phoenix dactylifera] Length = 171 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 330 MVTMVSRQGRHLQRYTTQGRRRIVGCIPYR 419 MV++VSRQGRHLQRYT+ GRR +VGCIPY+ Sbjct: 1 MVSLVSRQGRHLQRYTSTGRRLVVGCIPYK 30 >XP_004140308.1 PREDICTED: nudix hydrolase 18, mitochondrial [Cucumis sativus] KGN51037.1 MutT-like protein [Cucumis sativus] Length = 185 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 327 NMVTMVSRQGRHLQRYTTQGRRRIVGCIPYR 419 NMV++VSR GRHLQRY +GRR++VGCIPYR Sbjct: 9 NMVSLVSRTGRHLQRYDIRGRRQVVGCIPYR 39 >XP_018816555.1 PREDICTED: nudix hydrolase 17, mitochondrial-like [Juglans regia] Length = 180 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 3/53 (5%) Frame = +3 Query: 327 NMVTMVSRQGRHLQRYTTQGRRRIVGCIPYRLTHNNNYRLPIS---DNAGGVE 476 NMV +VSR GRHLQRY GRR++VGCIPYR Y++P D AG +E Sbjct: 8 NMVALVSRTGRHLQRYNKLGRRQVVGCIPYR------YKIPKQTSLDAAGELE 54 >XP_017636177.1 PREDICTED: nudix hydrolase 18, mitochondrial-like [Gossypium arboreum] KHG14906.1 Nudix hydrolase 18, mitochondrial -like protein [Gossypium arboreum] Length = 172 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +3 Query: 330 MVTMVSRQGRHLQRYTTQGRRRIVGCIPYRLTHNNN 437 MV +VSR GRHLQRY GRR++VGCIPYR N++ Sbjct: 1 MVCLVSRTGRHLQRYDALGRRQVVGCIPYRYKRNSD 36 >XP_020099712.1 nudix hydrolase 17, mitochondrial [Ananas comosus] Length = 165 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +3 Query: 330 MVTMVSRQGRHLQRYTTQGRRRIVGCIPYRLTHNN 434 M ++VSRQGR LQRY++ GRR +VGCIPY+L+ N+ Sbjct: 1 MASLVSRQGRQLQRYSSNGRRLVVGCIPYKLSTNS 35