BLASTX nr result
ID: Alisma22_contig00004787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00004787 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB55918.1 hypothetical protein B456_009G101300 [Gossypium raimo... 117 5e-32 XP_006436043.1 hypothetical protein CICLE_v10033065mg [Citrus cl... 117 5e-32 XP_015939352.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis ... 117 1e-31 XP_017423029.1 PREDICTED: 40S ribosomal protein S15a [Vigna angu... 117 1e-31 XP_011073215.1 PREDICTED: 40S ribosomal protein S15a-1-like [Ses... 117 1e-31 XP_011073203.1 PREDICTED: 40S ribosomal protein S15a-like [Sesam... 117 1e-31 XP_010937690.1 PREDICTED: 40S ribosomal protein S15a [Elaeis gui... 117 1e-31 XP_010520725.1 PREDICTED: 40S ribosomal protein S15a-1-like [Tar... 117 1e-31 XP_010253275.1 PREDICTED: 40S ribosomal protein S15a-1 [Nelumbo ... 117 1e-31 XP_009403451.1 PREDICTED: 40S ribosomal protein S15a-like [Musa ... 117 1e-31 XP_008776460.1 PREDICTED: 40S ribosomal protein S15a-like [Phoen... 117 1e-31 CDP09021.1 unnamed protein product [Coffea canephora] 117 1e-31 XP_002528466.1 PREDICTED: 40S ribosomal protein S15a-1 [Ricinus ... 117 1e-31 XP_007154598.1 hypothetical protein PHAVU_003G132300g [Phaseolus... 117 1e-31 EPS62189.1 hypothetical protein M569_12604 [Genlisea aurea] 117 1e-31 NP_001238465.1 uncharacterized protein LOC100305645 [Glycine max... 117 1e-31 ADR71250.1 40S ribosomal protein S15C [Hevea brasiliensis] 117 1e-31 KJB55922.1 hypothetical protein B456_009G101300 [Gossypium raimo... 117 1e-31 KJB20165.1 hypothetical protein B456_003G136100 [Gossypium raimo... 116 2e-31 XP_008370958.1 PREDICTED: 40S ribosomal protein S15a-1-like isof... 117 2e-31 >KJB55918.1 hypothetical protein B456_009G101300 [Gossypium raimondii] KJB55919.1 hypothetical protein B456_009G101300 [Gossypium raimondii] KJB55921.1 hypothetical protein B456_009G101300 [Gossypium raimondii] Length = 97 Score = 117 bits (294), Expect = 5e-32 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_006436043.1 hypothetical protein CICLE_v10033065mg [Citrus clementina] ESR49283.1 hypothetical protein CICLE_v10033065mg [Citrus clementina] Length = 103 Score = 117 bits (294), Expect = 5e-32 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_015939352.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis duranensis] XP_015958683.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis duranensis] XP_015941479.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis duranensis] XP_015941480.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis duranensis] XP_016196592.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis ipaensis] XP_016197392.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis ipaensis] XP_016176766.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis ipaensis] XP_016176767.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis ipaensis] XP_016176768.1 PREDICTED: 40S ribosomal protein S15a-1 [Arachis ipaensis] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_017423029.1 PREDICTED: 40S ribosomal protein S15a [Vigna angularis] XP_017423037.1 PREDICTED: 40S ribosomal protein S15a [Vigna angularis] XP_017429254.1 PREDICTED: 40S ribosomal protein S15a [Vigna angularis] KOM33595.1 hypothetical protein LR48_Vigan01g315100 [Vigna angularis] KOM47694.1 hypothetical protein LR48_Vigan07g139800 [Vigna angularis] BAT76863.1 hypothetical protein VIGAN_01492500 [Vigna angularis var. angularis] BAT77226.1 hypothetical protein VIGAN_01532300 [Vigna angularis var. angularis] ONK67789.1 uncharacterized protein A4U43_C05F3790 [Asparagus officinalis] ONK78473.1 uncharacterized protein A4U43_C02F19140 [Asparagus officinalis] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_011073215.1 PREDICTED: 40S ribosomal protein S15a-1-like [Sesamum indicum] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_011073203.1 PREDICTED: 40S ribosomal protein S15a-like [Sesamum indicum] XP_011089429.1 PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] XP_011089430.1 PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] XP_020101076.1 40S ribosomal protein S15a [Ananas comosus] XP_020114388.1 40S ribosomal protein S15a [Ananas comosus] OAY65957.1 40S ribosomal protein S15a [Ananas comosus] OAY83572.1 40S ribosomal protein S15a [Ananas comosus] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_010937690.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010937692.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010937693.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010937694.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_010520725.1 PREDICTED: 40S ribosomal protein S15a-1-like [Tarenaya hassleriana] XP_010520726.1 PREDICTED: 40S ribosomal protein S15a-1-like [Tarenaya hassleriana] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_010253275.1 PREDICTED: 40S ribosomal protein S15a-1 [Nelumbo nucifera] XP_010260081.1 PREDICTED: 40S ribosomal protein S15a-1 [Nelumbo nucifera] XP_019053590.1 PREDICTED: 40S ribosomal protein S15a-1 [Nelumbo nucifera] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_009403451.1 PREDICTED: 40S ribosomal protein S15a-like [Musa acuminata subsp. malaccensis] XP_009409007.1 PREDICTED: 40S ribosomal protein S15a-like [Musa acuminata subsp. malaccensis] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_008776460.1 PREDICTED: 40S ribosomal protein S15a-like [Phoenix dactylifera] XP_017696296.1 PREDICTED: 40S ribosomal protein S15a-like [Phoenix dactylifera] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >CDP09021.1 unnamed protein product [Coffea canephora] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_002528466.1 PREDICTED: 40S ribosomal protein S15a-1 [Ricinus communis] XP_015580405.1 PREDICTED: 40S ribosomal protein S15a-1 [Ricinus communis] EEF33949.1 30S ribosomal protein S8, putative [Ricinus communis] ADR71248.1 40S ribosomal protein S15A [Hevea brasiliensis] ADR71249.1 40S ribosomal protein S15B [Hevea brasiliensis] KDP29850.1 hypothetical protein JCGZ_18425 [Jatropha curcas] OAY37846.1 hypothetical protein MANES_11G133800 [Manihot esculenta] OAY38670.1 hypothetical protein MANES_10G034000 [Manihot esculenta] OAY51771.1 hypothetical protein MANES_04G031400 [Manihot esculenta] OAY51772.1 hypothetical protein MANES_04G031400 [Manihot esculenta] OAY59003.1 hypothetical protein MANES_02G223700 [Manihot esculenta] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >XP_007154598.1 hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] XP_009399987.1 PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] XP_009420087.1 PREDICTED: 40S ribosomal protein S15a [Musa acuminata subsp. malaccensis] XP_010922386.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_010905722.1 PREDICTED: 40S ribosomal protein S15a [Elaeis guineensis] XP_011089803.1 PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] ESW26592.1 hypothetical protein PHAVU_003G132300g [Phaseolus vulgaris] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >EPS62189.1 hypothetical protein M569_12604 [Genlisea aurea] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >NP_001238465.1 uncharacterized protein LOC100305645 [Glycine max] XP_003517588.1 PREDICTED: 40S ribosomal protein S15a-1 [Glycine max] XP_003529602.1 PREDICTED: 40S ribosomal protein S15a-1 [Glycine max] XP_003538955.1 PREDICTED: 40S ribosomal protein S15a-1 [Glycine max] XP_003539019.1 PREDICTED: 40S ribosomal protein S15a-1 [Glycine max] XP_006424761.1 hypothetical protein CICLE_v10029569mg [Citrus clementina] XP_006436044.1 hypothetical protein CICLE_v10033065mg [Citrus clementina] XP_006436045.1 hypothetical protein CICLE_v10033065mg [Citrus clementina] XP_006486064.1 PREDICTED: 40S ribosomal protein S15a-1 [Citrus sinensis] XP_006486065.1 PREDICTED: 40S ribosomal protein S15a-1 [Citrus sinensis] XP_006488266.1 PREDICTED: 40S ribosomal protein S15a-1 [Citrus sinensis] XP_007016503.1 PREDICTED: 40S ribosomal protein S15a-1 [Theobroma cacao] XP_007016504.1 PREDICTED: 40S ribosomal protein S15a-1 [Theobroma cacao] XP_007207491.1 hypothetical protein PRUPE_ppa013307mg [Prunus persica] XP_007207492.1 hypothetical protein PRUPE_ppa013307mg [Prunus persica] XP_007218592.1 hypothetical protein PRUPE_ppa013311mg [Prunus persica] XP_008223036.1 PREDICTED: 40S ribosomal protein S15a-1 [Prunus mume] XP_008233577.1 PREDICTED: 40S ribosomal protein S15a-1 [Prunus mume] XP_008357670.1 PREDICTED: 40S ribosomal protein S15a-1 [Malus domestica] XP_008385156.1 PREDICTED: 40S ribosomal protein S15a-1 [Malus domestica] XP_008343563.1 PREDICTED: 40S ribosomal protein S15a-1 [Malus domestica] XP_008343564.1 PREDICTED: 40S ribosomal protein S15a-1 [Malus domestica] XP_008349715.1 PREDICTED: 40S ribosomal protein S15a-1 [Malus domestica] XP_009357683.1 PREDICTED: 40S ribosomal protein S15a-1 [Pyrus x bretschneideri] XP_009357684.1 PREDICTED: 40S ribosomal protein S15a-1 [Pyrus x bretschneideri] XP_009358336.1 PREDICTED: 40S ribosomal protein S15a-1 [Pyrus x bretschneideri] XP_009338360.1 PREDICTED: 40S ribosomal protein S15a-1 [Pyrus x bretschneideri] XP_014619203.1 PREDICTED: 40S ribosomal protein S15a-1 [Glycine max] XP_014622820.1 PREDICTED: uncharacterized protein LOC100527843 isoform X1 [Glycine max] XP_016688543.1 PREDICTED: 40S ribosomal protein S15a-1-like [Gossypium hirsutum] XP_016688544.1 PREDICTED: 40S ribosomal protein S15a-1-like [Gossypium hirsutum] XP_017183287.1 PREDICTED: 40S ribosomal protein S15a-1 [Malus domestica] XP_017982063.1 PREDICTED: 40S ribosomal protein S15a-1 [Theobroma cacao] XP_017984131.1 PREDICTED: 40S ribosomal protein S15a-1 [Theobroma cacao] XP_019424647.1 PREDICTED: 40S ribosomal protein S15a-1-like [Lupinus angustifolius] XP_019424648.1 PREDICTED: 40S ribosomal protein S15a-1-like [Lupinus angustifolius] ACF22877.1 putative ribosomal protein S15 [Glycine max] ACU13431.1 unknown [Glycine max] EOY19087.1 Ribosomal protein S8 family protein [Theobroma cacao] EOY19089.1 Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] EOY19090.1 Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] EOY34122.1 Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] EOY34123.1 Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] EOY34124.1 Ribosomal protein S8 family protein isoform 1 [Theobroma cacao] EOY34126.1 Ribosomal protein S8 family protein isoform 5, partial [Theobroma cacao] ESR38001.1 hypothetical protein CICLE_v10029569mg [Citrus clementina] ESR49284.1 hypothetical protein CICLE_v10033065mg [Citrus clementina] ESR49285.1 hypothetical protein CICLE_v10033065mg [Citrus clementina] KDO67709.1 hypothetical protein CISIN_1g032930mg [Citrus sinensis] KDO67710.1 hypothetical protein CISIN_1g032930mg [Citrus sinensis] KDO67711.1 hypothetical protein CISIN_1g032930mg [Citrus sinensis] KDO72944.1 hypothetical protein CISIN_1g032932mg [Citrus sinensis] KHG12876.1 40S ribosomal S15a-1 -like protein [Gossypium arboreum] KHN03035.1 40S ribosomal protein S15a-1 [Glycine soja] KHN03431.1 40S ribosomal protein S15a-1 [Glycine soja] KHN30456.1 40S ribosomal protein S15a-1 [Glycine soja] KHN35194.1 40S ribosomal protein S15a-1 [Glycine soja] KHN35195.1 40S ribosomal protein S15a-1 [Glycine soja] KJB08853.1 hypothetical protein B456_001G108200 [Gossypium raimondii] KRH02138.1 hypothetical protein GLYMA_17G018600 [Glycine max] KRH27604.1 hypothetical protein GLYMA_11G003600 [Glycine max] KRH27605.1 hypothetical protein GLYMA_11G003600 [Glycine max] KRH27606.1 hypothetical protein GLYMA_11G003600 [Glycine max] KRH27608.1 hypothetical protein GLYMA_11G003700 [Glycine max] KRH27609.1 hypothetical protein GLYMA_11G003700 [Glycine max] KRH51002.1 hypothetical protein GLYMA_07G255500 [Glycine max] KRH77880.1 hypothetical protein GLYMA_01G240000 [Glycine max] KYP58173.1 40S ribosomal protein S15a-1 [Cajanus cajan] KYP66856.1 40S ribosomal protein S15a-1 [Cajanus cajan] KYP72812.1 40S ribosomal protein S15a-1 [Cajanus cajan] KYP75066.1 40S ribosomal protein S15a-1 [Cajanus cajan] OIV91964.1 hypothetical protein TanjilG_23225 [Lupinus angustifolius] OMO67698.1 Ribosomal protein S8 [Corchorus capsularis] OMO85339.1 Ribosomal protein S8 [Corchorus capsularis] OMO87659.1 Ribosomal protein S8 [Corchorus capsularis] ONI00340.1 hypothetical protein PRUPE_6G083600 [Prunus persica] ONI00341.1 hypothetical protein PRUPE_6G083600 [Prunus persica] ONI24216.1 hypothetical protein PRUPE_2G230100 [Prunus persica] ONI24217.1 hypothetical protein PRUPE_2G230100 [Prunus persica] ONI24218.1 hypothetical protein PRUPE_2G230100 [Prunus persica] Length = 130 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >ADR71250.1 40S ribosomal protein S15C [Hevea brasiliensis] Length = 131 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 8 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 65 >KJB55922.1 hypothetical protein B456_009G101300 [Gossypium raimondii] Length = 132 Score = 117 bits (294), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 64 >KJB20165.1 hypothetical protein B456_003G136100 [Gossypium raimondii] Length = 104 Score = 116 bits (291), Expect = 2e-31 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHR+GKIVVE Sbjct: 7 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRSGKIVVE 64 >XP_008370958.1 PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Malus domestica] XP_008343555.1 PREDICTED: 40S ribosomal protein S15a-1-like isoform X2 [Malus domestica] XP_009337579.1 PREDICTED: 40S ribosomal protein S15a-1 [Pyrus x bretschneideri] Length = 129 Score = 117 bits (293), Expect = 2e-31 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +3 Query: 207 LNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 380 LNDALKSMYNAEKRGKRQVMIRPSSKVI+KFLLVMQKHGYIGEFEYVDDHRAGKIVVE Sbjct: 6 LNDALKSMYNAEKRGKRQVMIRPSSKVIVKFLLVMQKHGYIGEFEYVDDHRAGKIVVE 63