BLASTX nr result
ID: Alisma22_contig00004640
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00004640 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010243713.1 PREDICTED: chlorophyll a-b binding protein of LHC... 52 5e-06 XP_018510339.1 PREDICTED: chlorophyll a-b binding protein 1, chl... 50 5e-06 AAA33396.1 light-harvesting chlorophyll a/b protein precursor [L... 52 6e-06 >XP_010243713.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Nelumbo nucifera] Length = 267 Score = 52.4 bits (124), Expect = 5e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 159 GKAVKLAPAASEILGSGRVTMRGKTVGKPKPV 254 GKAVKLAP+ASE+LG GR+TMR KTV KPKPV Sbjct: 15 GKAVKLAPSASELLGEGRITMR-KTVAKPKPV 45 >XP_018510339.1 PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like [Brassica rapa] Length = 122 Score = 50.4 bits (119), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 159 GKAVKLAPAASEILGSGRVTMRGKTVGKPK 248 GKAVKL+PAASE+LGSGRVTMR KTV KPK Sbjct: 15 GKAVKLSPAASEVLGSGRVTMR-KTVAKPK 43 >AAA33396.1 light-harvesting chlorophyll a/b protein precursor [Lemna gibba] Length = 266 Score = 52.0 bits (123), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 159 GKAVKLAPAASEILGSGRVTMRGKTVGKPKPV 254 GKAVKLAPAASE+ G GRV+MR KT GKPKPV Sbjct: 14 GKAVKLAPAASEVFGEGRVSMR-KTAGKPKPV 44