BLASTX nr result
ID: Alisma22_contig00004195
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00004195 (843 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002308043.1 hypothetical protein POPTR_0006s05300g [Populus t... 56 6e-07 >XP_002308043.1 hypothetical protein POPTR_0006s05300g [Populus trichocarpa] EEE91566.1 hypothetical protein POPTR_0006s05300g [Populus trichocarpa] Length = 66 Score = 55.8 bits (133), Expect = 6e-07 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -1 Query: 621 VAFSMAPLTLYLPPLRSFSLLVRSMEPFFKQAGVFTIRIRPHL 493 VAFS PLTLY+PP+RS SLLV ++E FF+Q ++T+R P + Sbjct: 8 VAFSAMPLTLYVPPIRSLSLLVETIEDFFRQTSLYTVRAYPRI 50