BLASTX nr result
ID: Alisma22_contig00004065
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00004065 (1537 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT60798.1 Adenosine monophosphate-protein transferase FICD, par... 58 1e-06 >JAT60798.1 Adenosine monophosphate-protein transferase FICD, partial [Anthurium amnicola] Length = 148 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 92 SEMGAYYKEMLQADPENPLLLMNYGKFLHQ 3 SEMGAYY+EML+ADP NPLLL NYGKFLH+ Sbjct: 17 SEMGAYYQEMLEADPANPLLLRNYGKFLHE 46