BLASTX nr result
ID: Alisma22_contig00003340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00003340 (845 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006423169.1 hypothetical protein CICLE_v10029754mg [Citrus cl... 55 9e-07 KCW63867.1 hypothetical protein EUGRSUZ_G01536 [Eucalyptus grandis] 55 1e-06 KCW63869.1 hypothetical protein EUGRSUZ_G01538 [Eucalyptus grandis] 55 2e-06 KCW62914.1 hypothetical protein EUGRSUZ_G00506 [Eucalyptus grandis] 54 3e-06 >XP_006423169.1 hypothetical protein CICLE_v10029754mg [Citrus clementina] ESR36409.1 hypothetical protein CICLE_v10029754mg [Citrus clementina] Length = 68 Score = 55.5 bits (132), Expect = 9e-07 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 4/84 (4%) Frame = -3 Query: 687 MSALVDIWMSELAKLGQ----RSPWAVQQSKRRRDNNVAAAKESKEQTSTESIKKEEXXX 520 MSA+V+I M ELAKLG+ R P+ ++ K + KE K++ ST+ ++ E Sbjct: 1 MSAVVEICMGELAKLGEKVKGRKPFVLRAKKEQ-----VRGKEDKKE-STKEVEDE---- 50 Query: 519 XXASCRATLSETTICMLMDRFAPC 448 +T+SETTIC+LMDRF PC Sbjct: 51 ------STISETTICLLMDRFVPC 68 >KCW63867.1 hypothetical protein EUGRSUZ_G01536 [Eucalyptus grandis] Length = 75 Score = 55.1 bits (131), Expect = 1e-06 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 5/84 (5%) Frame = -3 Query: 687 MSALVDIWMSELAKLGQRSPWAVQ-----QSKRRRDNNVAAAKESKEQTSTESIKKEEXX 523 MSALV+IW SELA+L +R AVQ +SK ++ +A E KE + KKEE Sbjct: 1 MSALVEIWESELARLRERV--AVQNLLGSKSKSEQERKESAGAERKESSPA---KKEEVP 55 Query: 522 XXXASCRATLSETTICMLMDRFAP 451 +T+SE T+C+LMDRF P Sbjct: 56 -----AESTISEATVCLLMDRFVP 74 >KCW63869.1 hypothetical protein EUGRSUZ_G01538 [Eucalyptus grandis] Length = 79 Score = 54.7 bits (130), Expect = 2e-06 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%) Frame = -3 Query: 687 MSALVDIWMSELAKLGQRSPWAVQQSKRRRDNNVAAAKESKEQTSTE-SIKKEEXXXXXA 511 MSALV IW SELAKLG++ A+++ R + + +ES E + S+ K+ Sbjct: 1 MSALVGIWESELAKLGEKV--AIKKLLRSKSKSDQEREESVEADPKKLSMAKKGERRREV 58 Query: 510 SCRATLSETTICMLMDRFAPC 448 +T+SE T+C+L+DRF PC Sbjct: 59 PVESTISEATMCLLVDRFVPC 79 >KCW62914.1 hypothetical protein EUGRSUZ_G00506 [Eucalyptus grandis] Length = 75 Score = 54.3 bits (129), Expect = 3e-06 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 2/81 (2%) Frame = -3 Query: 687 MSALVDIWMSELAKLGQRSPWAVQQSKRRRDNNVAAAKESK--EQTSTESIKKEEXXXXX 514 MSALV+IW SELA+L +R AVQ+ + + KES E+ + KKEE Sbjct: 1 MSALVEIWESELARLRERV--AVQKLLGSKSKSEQERKESARAERKDSSPAKKEEVP--- 55 Query: 513 ASCRATLSETTICMLMDRFAP 451 +T+SE T+C+LMDRF P Sbjct: 56 --AESTISEATVCLLMDRFVP 74