BLASTX nr result
ID: Alisma22_contig00002912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00002912 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMZ68286.1 Outer envelope pore protein 16, chloroplastic [Zoster... 75 2e-14 NP_001145448.1 uncharacterized protein LOC100278827 [Zea mays] A... 72 9e-14 XP_002439146.1 hypothetical protein SORBIDRAFT_09g001310 [Sorghu... 72 1e-13 XP_004960518.1 PREDICTED: outer envelope pore protein 16, chloro... 72 1e-13 AQK79411.1 Putative amino acid selective channel family protein ... 72 2e-13 NP_001151965.1 amino acid selective channel protein [Zea mays] A... 72 2e-13 ACG31308.1 amino acid selective channel protein [Zea mays] 72 2e-13 XP_006653965.1 PREDICTED: outer envelope pore protein 16, chloro... 71 5e-13 XP_008357200.1 PREDICTED: outer envelope pore protein 16, chloro... 70 7e-13 AQK79410.1 Putative amino acid selective channel family protein ... 72 8e-13 XP_008656555.1 PREDICTED: outer envelope pore protein 16, chloro... 70 1e-12 XP_015638724.1 PREDICTED: outer envelope pore protein 16, chloro... 70 1e-12 XP_010252115.1 PREDICTED: outer envelope pore protein 16, chloro... 69 2e-12 GAU17335.1 hypothetical protein TSUD_110520 [Trifolium subterran... 67 2e-12 XP_009341406.1 PREDICTED: outer envelope pore protein 16, chloro... 69 3e-12 XP_009364401.1 PREDICTED: outer envelope pore protein 16, chloro... 69 3e-12 XP_013465403.1 outer envelope pore protein [Medicago truncatula]... 67 5e-12 AFK37994.1 unknown [Lotus japonicus] 67 1e-11 XP_009380643.1 PREDICTED: outer envelope pore protein 16, chloro... 67 1e-11 XP_004487008.1 PREDICTED: outer envelope pore protein 16, chloro... 67 1e-11 >KMZ68286.1 Outer envelope pore protein 16, chloroplastic [Zostera marina] Length = 146 Score = 74.7 bits (182), Expect = 2e-14 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MPW++ISGS P++D++IDMGNPFLNR+VDGFLKIGVVGA +V Sbjct: 1 MPWSTISGSWNSPRVDLVIDMGNPFLNRSVDGFLKIGVVGATRV 44 >NP_001145448.1 uncharacterized protein LOC100278827 [Zea mays] ACG47676.1 hypothetical protein [Zea mays] Length = 121 Score = 72.0 bits (175), Expect = 9e-14 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + SGS PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRSGFSGSFRSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >XP_002439146.1 hypothetical protein SORBIDRAFT_09g001310 [Sorghum bicolor] ACE86395.1 amino acid selective channel protein [Sorghum bicolor] EES17576.1 hypothetical protein SORBI_009G013400 [Sorghum bicolor] KXG21091.1 hypothetical protein SORBI_009G013400 [Sorghum bicolor] Length = 146 Score = 72.4 bits (176), Expect = 1e-13 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP SGSL PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRGGFSGSLRSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >XP_004960518.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Setaria italica] KQL13374.1 hypothetical protein SETIT_023559mg [Setaria italica] Length = 146 Score = 72.4 bits (176), Expect = 1e-13 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP SGSL PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPHGRFSGSLSSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >AQK79411.1 Putative amino acid selective channel family protein [Zea mays] Length = 142 Score = 72.0 bits (175), Expect = 2e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + SGS PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRSGFSGSFRSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >NP_001151965.1 amino acid selective channel protein [Zea mays] ACG36032.1 amino acid selective channel protein [Zea mays] ACG36045.1 amino acid selective channel protein [Zea mays] ACG45165.1 amino acid selective channel protein [Zea mays] AQK79405.1 Putative amino acid selective channel family protein [Zea mays] AQK79406.1 Putative amino acid selective channel family protein [Zea mays] AQK79407.1 Putative amino acid selective channel family protein [Zea mays] AQK79408.1 Putative amino acid selective channel family protein [Zea mays] AQK79409.1 Putative amino acid selective channel family protein [Zea mays] Length = 146 Score = 72.0 bits (175), Expect = 2e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + SGS PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRSGFSGSFRSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >ACG31308.1 amino acid selective channel protein [Zea mays] Length = 146 Score = 72.0 bits (175), Expect = 2e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + SGS PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRSGFSGSFSSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >XP_006653965.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Oryza brachyantha] Length = 146 Score = 70.9 bits (172), Expect = 5e-13 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP SGS+ PKIDV IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRGGFSGSISSPKIDVAIDMGNPFLNRTVDGFLKIGAVGACKV 44 >XP_008357200.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Malus domestica] Length = 146 Score = 70.5 bits (171), Expect = 7e-13 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP TS +GSL GPK+DVMID+GNPF N TVDGFLKIG V A +V Sbjct: 1 MPRTSFAGSLTGPKVDVMIDLGNPFFNHTVDGFLKIGTVAATRV 44 >AQK79410.1 Putative amino acid selective channel family protein [Zea mays] Length = 229 Score = 72.0 bits (175), Expect = 8e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + SGS PKIDV+IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRSGFSGSFRSPKIDVVIDMGNPFLNRTVDGFLKIGAVGACKV 44 >XP_008656555.1 PREDICTED: outer envelope pore protein 16, chloroplastic-like [Zea mays] AQK95516.1 Putative mitochondrial import inner membrane translocase subunit Tim17 family protein [Zea mays] AQK95517.1 Putative mitochondrial import inner membrane translocase subunit Tim17 family protein [Zea mays] Length = 146 Score = 70.1 bits (170), Expect = 1e-12 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + ISG+L P+IDV+ID GNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRSGISGTLRSPQIDVVIDTGNPFLNRTVDGFLKIGAVGACKV 44 >XP_015638724.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Oryza sativa Japonica Group] AAU44206.1 putative amino acid selective channel protein [Oryza sativa Japonica Group] BAF16360.1 Os05g0111200 [Oryza sativa Japonica Group] BAG95191.1 unnamed protein product [Oryza sativa Japonica Group] EEC78389.1 hypothetical protein OsI_18168 [Oryza sativa Indica Group] EEE62078.1 hypothetical protein OsJ_16862 [Oryza sativa Japonica Group] BAS91925.1 Os05g0111200 [Oryza sativa Japonica Group] Length = 146 Score = 69.7 bits (169), Expect = 1e-12 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP SGS+ P+IDV IDMGNPFLNRTVDGFLKIG VGA KV Sbjct: 1 MPRGGFSGSISSPRIDVAIDMGNPFLNRTVDGFLKIGAVGACKV 44 >XP_010252115.1 PREDICTED: outer envelope pore protein 16, chloroplastic-like [Nelumbo nucifera] Length = 146 Score = 69.3 bits (168), Expect = 2e-12 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + +SGS PK+DV+IDMGNPFLN TVDGF+KIG VGAA+V Sbjct: 1 MPRSRLSGSFNSPKVDVVIDMGNPFLNHTVDGFVKIGTVGAARV 44 >GAU17335.1 hypothetical protein TSUD_110520 [Trifolium subterraneum] Length = 77 Score = 67.4 bits (163), Expect = 2e-12 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAK 383 MPW+ ISGS+ P++DV IDMGNPFLN T+DGFLKIG V A + Sbjct: 1 MPWSRISGSVSSPQVDVAIDMGNPFLNLTLDGFLKIGTVAATR 43 >XP_009341406.1 PREDICTED: outer envelope pore protein 16, chloroplastic-like [Pyrus x bretschneideri] Length = 146 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP +S +GSL GPK+DVMID+GNPF N TVDGFLKIG V A +V Sbjct: 1 MPRSSFAGSLTGPKVDVMIDLGNPFFNHTVDGFLKIGTVAATRV 44 >XP_009364401.1 PREDICTED: outer envelope pore protein 16, chloroplastic-like [Pyrus x bretschneideri] XP_009364415.1 PREDICTED: outer envelope pore protein 16, chloroplastic-like [Pyrus x bretschneideri] Length = 146 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP +S +GSL GPK+DVMID+GNPF N TVDGFLKIG V A +V Sbjct: 1 MPRSSFAGSLTGPKVDVMIDLGNPFFNHTVDGFLKIGTVAATRV 44 >XP_013465403.1 outer envelope pore protein [Medicago truncatula] KEH39438.1 outer envelope pore protein [Medicago truncatula] Length = 114 Score = 67.4 bits (163), Expect = 5e-12 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAK 383 MPW+ ISGS+ P++DV+IDMGNPFLN VDGFLKIG V A + Sbjct: 1 MPWSRISGSVSSPQVDVVIDMGNPFLNLAVDGFLKIGTVAATR 43 >AFK37994.1 unknown [Lotus japonicus] Length = 127 Score = 67.0 bits (162), Expect = 1e-11 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAK 383 MP +SISGS+ PK+DV IDMGNPFLN TVDGFLKIG V A + Sbjct: 1 MPLSSISGSVSSPKVDVAIDMGNPFLNLTVDGFLKIGAVAATR 43 >XP_009380643.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Musa acuminata subsp. malaccensis] XP_009380644.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Musa acuminata subsp. malaccensis] XP_009380645.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Musa acuminata subsp. malaccensis] Length = 146 Score = 67.4 bits (163), Expect = 1e-11 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAKV 386 MP + ++GS+ PKIDV+ID GNPFLNRTVDGFLKIG V A+KV Sbjct: 1 MPRSVLAGSISSPKIDVVIDTGNPFLNRTVDGFLKIGTVAASKV 44 >XP_004487008.1 PREDICTED: outer envelope pore protein 16, chloroplastic [Cicer arietinum] Length = 146 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 255 MPWTSISGSLEGPKIDVMIDMGNPFLNRTVDGFLKIGVVGAAK 383 MPW+ +SGS+ P +DV+IDMGNPFLN TVDGFLKIG V A + Sbjct: 1 MPWSRMSGSVSSPTVDVVIDMGNPFLNLTVDGFLKIGAVAATR 43