BLASTX nr result
ID: Alisma22_contig00002717
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00002717 (2064 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KFQ18267.1 hypothetical protein N331_07155, partial [Merops nubi... 65 4e-09 >KFQ18267.1 hypothetical protein N331_07155, partial [Merops nubicus] Length = 135 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/86 (41%), Positives = 48/86 (55%), Gaps = 4/86 (4%) Frame = -3 Query: 670 RCLNRIPFRTPRHSQNR--HQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHR 497 R +R P RTP + +R H+T + P+RTP RT H +TP +P R P RT R Sbjct: 11 RTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPH 70 Query: 496 RIQNRRLSR--HQTPHQTQHLSQHRT 425 R +R R H+TPH+T H + HRT Sbjct: 71 RTPHRTPHRTPHRTPHRTPHRTPHRT 96 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/86 (41%), Positives = 48/86 (55%), Gaps = 4/86 (4%) Frame = -3 Query: 670 RCLNRIPFRTPRHSQNR--HQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHR 497 R +R P RTP + +R H+T + P+RTP RT H +TP +P R P RT R Sbjct: 35 RTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPH 94 Query: 496 RIQNRRLSR--HQTPHQTQHLSQHRT 425 R +R R H+TPH+T H + HRT Sbjct: 95 RTPHRTPHRTPHRTPHRTPHRTPHRT 120 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/86 (41%), Positives = 48/86 (55%), Gaps = 4/86 (4%) Frame = -3 Query: 670 RCLNRIPFRTPRHSQNR--HQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHR 497 R +R P RTP + +R H+T + P+RTP RT H +TP +P R P RT R Sbjct: 39 RTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPH 98 Query: 496 RIQNRRLSR--HQTPHQTQHLSQHRT 425 R +R R H+TPH+T H + HRT Sbjct: 99 RTPHRTPHRTPHRTPHRTPHRTPHRT 124 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/86 (41%), Positives = 48/86 (55%), Gaps = 4/86 (4%) Frame = -3 Query: 670 RCLNRIPFRTPRHSQNR--HQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHR 497 R +R P RTP + +R H+T + P+RTP RT H +TP +P R P RT R Sbjct: 43 RTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPH 102 Query: 496 RIQNRRLSR--HQTPHQTQHLSQHRT 425 R +R R H+TPH+T H + HRT Sbjct: 103 RTPHRTPHRTPHRTPHRTPHRTPHRT 128 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/86 (41%), Positives = 48/86 (55%), Gaps = 4/86 (4%) Frame = -3 Query: 670 RCLNRIPFRTPRHSQNR--HQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHR 497 R +R P RTP + +R H+T + P+RTP RT H +TP +P R P RT R Sbjct: 47 RTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPH 106 Query: 496 RIQNRRLSR--HQTPHQTQHLSQHRT 425 R +R R H+TPH+T H + HRT Sbjct: 107 RTPHRTPHRTPHRTPHRTPHRTPHRT 132 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/83 (39%), Positives = 45/83 (54%), Gaps = 2/83 (2%) Frame = -3 Query: 670 RCLNRIPFRTPRHSQNR--HQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHR 497 R +R P RTP + +R H+T + P+RTP RT H +TP +P R P RT R Sbjct: 59 RTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPH 118 Query: 496 RIQNRRLSRHQTPHQTQHLSQHR 428 R + H+TPH+T H + HR Sbjct: 119 R------TPHRTPHRTPHRTPHR 135 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = -3 Query: 631 SQNRHQTQIQNPYRTPRRTLHLGHRQTPIPSPFRIPRRTLRRVHRRIQNRRLSR--HQTP 458 S H+T + P+RTP RT H +TP +P R P RT R R +R R H+TP Sbjct: 2 SHPEHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTPHRTP 61 Query: 457 HQTQHLSQHRT 425 H+T H + HRT Sbjct: 62 HRTPHRTPHRT 72