BLASTX nr result
ID: Alisma22_contig00002675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00002675 (290 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010061981.1 PREDICTED: transcription repressor MYB6 [Eucalypt... 53 4e-06 >XP_010061981.1 PREDICTED: transcription repressor MYB6 [Eucalyptus grandis] KCW69028.1 hypothetical protein EUGRSUZ_F02583 [Eucalyptus grandis] Length = 301 Score = 53.1 bits (126), Expect = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 3 WNTHIKRKLVSQGIDPKTHLNLDTAVSGSPP 95 WNTHIKRKLVS+GIDP+TH L++AV G PP Sbjct: 108 WNTHIKRKLVSRGIDPQTHRPLNSAVPGVPP 138