BLASTX nr result
ID: Alisma22_contig00002221
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00002221 (558 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012840421.1 PREDICTED: 60S ribosomal protein L29-1-like [Eryt... 107 2e-27 BAA96072.1 ribosomal protein L29 [Panax ginseng] 106 3e-27 KVH99849.1 Ribosomal protein L29e [Cynara cardunculus var. scoly... 106 4e-27 XP_015899961.1 PREDICTED: 60S ribosomal protein L29-2-like [Zizi... 105 6e-27 ADV02780.1 putative 60S ribosomal protein L29 [Ipomoea batatas] 105 6e-27 XP_010558440.1 PREDICTED: 60S ribosomal protein L29-1-like [Tare... 105 9e-27 XP_009800219.1 PREDICTED: 60S ribosomal protein L29-1-like [Nico... 105 9e-27 XP_009789604.1 PREDICTED: 60S ribosomal protein L29-1-like [Nico... 105 9e-27 XP_009607972.1 PREDICTED: 60S ribosomal protein L29-1-like [Nico... 105 9e-27 XP_008390550.1 PREDICTED: 60S ribosomal protein L29-1-like [Malu... 105 9e-27 XP_019255269.1 PREDICTED: 60S ribosomal protein L29-2-like [Nico... 105 1e-26 XP_018805403.1 PREDICTED: 60S ribosomal protein L29-1-like [Jugl... 105 1e-26 XP_002276776.1 PREDICTED: 60S ribosomal protein L29-1 [Vitis vin... 105 1e-26 XP_004295099.1 PREDICTED: 60S ribosomal protein L29-1-like [Frag... 105 1e-26 XP_007227529.1 hypothetical protein PRUPE_ppa014537mg [Prunus pe... 105 1e-26 GAV70875.1 Ribosomal_L29e domain-containing protein [Cephalotus ... 104 2e-26 KZV17025.1 hypothetical protein F511_20824 [Dorcoceras hygrometr... 104 2e-26 XP_008458371.1 PREDICTED: 60S ribosomal protein L29-1-like [Cucu... 104 2e-26 AAG49033.1 ripening regulated protein DDTFR19 [Solanum lycopersi... 104 2e-26 NP_001234479.2 ripening regulated protein DDTFR19 [Solanum lycop... 104 2e-26 >XP_012840421.1 PREDICTED: 60S ribosomal protein L29-1-like [Erythranthe guttata] XP_012840425.1 PREDICTED: 60S ribosomal protein L29-1-like [Erythranthe guttata] EYU45506.1 hypothetical protein MIMGU_mgv1a017587mg [Erythranthe guttata] EYU45507.1 hypothetical protein MIMGU_mgv1a017587mg [Erythranthe guttata] Length = 61 Score = 107 bits (266), Expect = 2e-27 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKP++HRN STKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSHKAHRNGIKKPKRHRNISTKGMDPKFLRNQRYARKHNNK 52 >BAA96072.1 ribosomal protein L29 [Panax ginseng] Length = 61 Score = 106 bits (265), Expect = 3e-27 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKPRKHR+ ST+GMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSHKAHRNGIKKPRKHRHTSTRGMDPKFLRNQRYARKHNNK 52 >KVH99849.1 Ribosomal protein L29e [Cynara cardunculus var. scolymus] Length = 60 Score = 106 bits (264), Expect = 4e-27 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKPRKHR+ STKGMDPKFLRNQRYARKHNN+ Sbjct: 1 MAKSKNHTAHNQSHKAHRNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNQ 52 >XP_015899961.1 PREDICTED: 60S ribosomal protein L29-2-like [Ziziphus jujuba] Length = 60 Score = 105 bits (263), Expect = 6e-27 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAH+NGIKKPRKHR+ STKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 52 >ADV02780.1 putative 60S ribosomal protein L29 [Ipomoea batatas] Length = 61 Score = 105 bits (263), Expect = 6e-27 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAH+NGIKKPRKHR+ STKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYARKHNNK 52 >XP_010558440.1 PREDICTED: 60S ribosomal protein L29-1-like [Tarenaya hassleriana] Length = 61 Score = 105 bits (262), Expect = 9e-27 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAH+NGIKKPR+HR+ STKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSHKAHKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNNK 52 >XP_009800219.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] XP_019245278.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana attenuata] XP_019245279.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana attenuata] Length = 61 Score = 105 bits (262), Expect = 9e-27 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNN 225 MAKSKNHTAHNQS KAHRNGIKKPRKHR++STKGMDPKFLRNQRYARKHNN Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNN 51 >XP_009789604.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] XP_009789605.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana sylvestris] XP_016454572.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tabacum] XP_016454573.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tabacum] XP_019241343.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana attenuata] Length = 61 Score = 105 bits (262), Expect = 9e-27 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNN 225 MAKSKNHTAHNQS KAHRNGIKKPRKHR++STKGMDPKFLRNQRYARKHNN Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNN 51 >XP_009607972.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tomentosiformis] XP_016481985.1 PREDICTED: 60S ribosomal protein L29-1-like [Nicotiana tabacum] Length = 61 Score = 105 bits (262), Expect = 9e-27 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNN 225 MAKSKNHTAHNQS KAHRNGIKKPRKHR++STKGMDPKFLRNQRYARKHNN Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNN 51 >XP_008390550.1 PREDICTED: 60S ribosomal protein L29-1-like [Malus domestica] XP_009348879.1 PREDICTED: 60S ribosomal protein L29-1-like [Pyrus x bretschneideri] Length = 61 Score = 105 bits (262), Expect = 9e-27 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNN 225 MAKSKNHTAHNQSRKAHRNGIKKP++HR+ STKGMDPKFLRNQRYARKHNN Sbjct: 1 MAKSKNHTAHNQSRKAHRNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNN 51 >XP_019255269.1 PREDICTED: 60S ribosomal protein L29-2-like [Nicotiana attenuata] Length = 60 Score = 105 bits (261), Expect = 1e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKPRKHR+ S+KGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHRSSKGMDPKFLRNQRYARKHNNK 52 >XP_018805403.1 PREDICTED: 60S ribosomal protein L29-1-like [Juglans regia] XP_018805404.1 PREDICTED: 60S ribosomal protein L29-1-like [Juglans regia] Length = 61 Score = 105 bits (261), Expect = 1e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAH+NGIKKPRKHR+ASTKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHASTKGMDPKFLRNQRYARKHNKK 52 >XP_002276776.1 PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] CAN65958.1 hypothetical protein VITISV_007494 [Vitis vinifera] CBI22904.3 unnamed protein product, partial [Vitis vinifera] Length = 61 Score = 105 bits (261), Expect = 1e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAH+NGIKKPRKHR+ASTKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHASTKGMDPKFLRNQRYARKHNKK 52 >XP_004295099.1 PREDICTED: 60S ribosomal protein L29-1-like [Fragaria vesca subsp. vesca] Length = 61 Score = 105 bits (261), Expect = 1e-26 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNN 225 MAKSKNHTAHNQSRKAHRNGIKKP++HR+ STKGMDPKFLRNQRYARKHNN Sbjct: 1 MAKSKNHTAHNQSRKAHRNGIKKPQRHRHTSTKGMDPKFLRNQRYARKHNN 51 >XP_007227529.1 hypothetical protein PRUPE_ppa014537mg [Prunus persica] XP_007227530.1 hypothetical protein PRUPE_ppa014537mg [Prunus persica] XP_008223313.1 PREDICTED: 60S ribosomal protein L29-1-like [Prunus mume] ONI28089.1 hypothetical protein PRUPE_1G122500 [Prunus persica] ONI28090.1 hypothetical protein PRUPE_1G122500 [Prunus persica] Length = 61 Score = 105 bits (261), Expect = 1e-26 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNN 225 MAKSKNHTAHNQSRKAHRNGIKKP++HR+ STKGMDPKFLRNQRYARKHNN Sbjct: 1 MAKSKNHTAHNQSRKAHRNGIKKPQRHRHTSTKGMDPKFLRNQRYARKHNN 51 >GAV70875.1 Ribosomal_L29e domain-containing protein [Cephalotus follicularis] Length = 61 Score = 104 bits (260), Expect = 2e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKPRKHR++STKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSFKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNKK 52 >KZV17025.1 hypothetical protein F511_20824 [Dorcoceras hygrometricum] Length = 61 Score = 104 bits (260), Expect = 2e-26 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKP++HR++STKGMDPKFLRNQRYARKHNNK Sbjct: 1 MAKSKNHTAHNQSFKAHRNGIKKPKRHRHSSTKGMDPKFLRNQRYARKHNNK 52 >XP_008458371.1 PREDICTED: 60S ribosomal protein L29-1-like [Cucumis melo] Length = 61 Score = 104 bits (260), Expect = 2e-26 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAH+NGIKKPRKHR+ STKGMDPKFLRNQRYA+KHNNK Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNNK 52 >AAG49033.1 ripening regulated protein DDTFR19 [Solanum lycopersicum] Length = 54 Score = 104 bits (259), Expect = 2e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKPRKHR++STKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNPK 52 >NP_001234479.2 ripening regulated protein DDTFR19 [Solanum lycopersicum] XP_010314666.1 PREDICTED: ripening regulated protein DDTFR19 isoform X1 [Solanum lycopersicum] XP_015059452.1 PREDICTED: 60S ribosomal protein L29-2-like [Solanum pennellii] XP_015059453.1 PREDICTED: 60S ribosomal protein L29-2-like [Solanum pennellii] Length = 59 Score = 104 bits (259), Expect = 2e-26 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 73 MAKSKNHTAHNQSRKAHRNGIKKPRKHRNASTKGMDPKFLRNQRYARKHNNK 228 MAKSKNHTAHNQS KAHRNGIKKPRKHR++STKGMDPKFLRNQRYARKHN K Sbjct: 1 MAKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHNPK 52