BLASTX nr result
ID: Alisma22_contig00002101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00002101 (957 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020102270.1 50S ribosomal protein L34, chloroplastic-like [An... 95 4e-20 JAT57875.1 50S ribosomal protein L34, chloroplastic, partial [An... 92 9e-20 XP_012450509.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 94 1e-19 XP_020114214.1 50S ribosomal protein L34, chloroplastic-like [An... 94 1e-19 XP_016754071.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 93 1e-19 XP_016683329.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 93 1e-19 ONK78486.1 uncharacterized protein A4U43_C02F19270 [Asparagus of... 93 2e-19 XP_017631621.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 92 4e-19 JAT64435.1 50S ribosomal protein L34, chloroplastic, partial [An... 92 5e-19 XP_009386293.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 91 1e-18 OMO65329.1 Ribosomal protein L34 [Corchorus olitorius] 88 2e-18 P82244.1 RecName: Full=50S ribosomal protein L34, chloroplastic;... 90 2e-18 CBI30669.3 unnamed protein product, partial [Vitis vinifera] 89 3e-18 KHG06612.1 50S ribosomal protein L34, chloroplastic [Gossypium a... 92 4e-18 XP_008349209.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 89 4e-18 XP_008371452.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 89 4e-18 XP_017603423.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 89 5e-18 XP_016687506.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 89 5e-18 XP_007025416.1 PREDICTED: 50S ribosomal protein L34, chloroplast... 89 6e-18 XP_002274637.3 PREDICTED: 50S ribosomal protein L34, chloroplast... 89 7e-18 >XP_020102270.1 50S ribosomal protein L34, chloroplastic-like [Ananas comosus] OAY74832.1 50S ribosomal protein L34, chloroplastic [Ananas comosus] Length = 155 Score = 94.7 bits (234), Expect = 4e-20 Identities = 53/78 (67%), Positives = 56/78 (71%) Frame = +1 Query: 430 DFGNVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRA 609 D G+ V +R R LQVRAGKAALC+TKRSRSRKSLA AVLKRRRA Sbjct: 78 DLGSNRVVRERYRGLQVRAGKAALCMTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRA 137 Query: 610 KGRKVLCTKSNPSSGKRA 663 KGRKVLCTKSNPSSGKRA Sbjct: 138 KGRKVLCTKSNPSSGKRA 155 >JAT57875.1 50S ribosomal protein L34, chloroplastic, partial [Anthurium amnicola] Length = 111 Score = 92.4 bits (228), Expect = 9e-20 Identities = 51/78 (65%), Positives = 54/78 (69%) Frame = +1 Query: 430 DFGNVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRA 609 D G V +R R LQVRAGKA LC+TKR+RSRKSLA AVLKRRRA Sbjct: 34 DLGFSNVRRERHRGLQVRAGKATLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRA 93 Query: 610 KGRKVLCTKSNPSSGKRA 663 KGRKVLCTKSNPSSGKRA Sbjct: 94 KGRKVLCTKSNPSSGKRA 111 >XP_012450509.1 PREDICTED: 50S ribosomal protein L34, chloroplastic [Gossypium raimondii] KJB63242.1 hypothetical protein B456_010G1587002 [Gossypium raimondii] Length = 153 Score = 93.6 bits (231), Expect = 1e-19 Identities = 53/78 (67%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +1 Query: 430 DFG-NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRR 606 DFG N GV +RRR L VRAGKAALC TKR+RSRKSLA AVLKRRR Sbjct: 76 DFGSNKGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 135 Query: 607 AKGRKVLCTKSNPSSGKR 660 AKGRKVLCTKSNP+SGKR Sbjct: 136 AKGRKVLCTKSNPNSGKR 153 >XP_020114214.1 50S ribosomal protein L34, chloroplastic-like [Ananas comosus] Length = 155 Score = 93.6 bits (231), Expect = 1e-19 Identities = 52/78 (66%), Positives = 56/78 (71%) Frame = +1 Query: 430 DFGNVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRA 609 D G+ V +R R LQVRAGKAALC+TKRSRSRKSLA A+LKRRRA Sbjct: 78 DLGSNKVVRERYRGLQVRAGKAALCMTKRSRSRKSLARTHGFRRRMRTTSGRALLKRRRA 137 Query: 610 KGRKVLCTKSNPSSGKRA 663 KGRKVLCTKSNPSSGKRA Sbjct: 138 KGRKVLCTKSNPSSGKRA 155 >XP_016754071.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium hirsutum] Length = 152 Score = 93.2 bits (230), Expect = 1e-19 Identities = 53/78 (67%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +1 Query: 430 DFG-NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRR 606 DFG N GV +RRR L VRAGKAALC TKR+RSRKSLA AVLKRRR Sbjct: 75 DFGSNNGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 134 Query: 607 AKGRKVLCTKSNPSSGKR 660 AKGRKVLCTKSNP+SGKR Sbjct: 135 AKGRKVLCTKSNPNSGKR 152 >XP_016683329.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium hirsutum] Length = 153 Score = 93.2 bits (230), Expect = 1e-19 Identities = 53/78 (67%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +1 Query: 430 DFG-NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRR 606 DFG N GV +RRR L VRAGKAALC TKR+RSRKSLA AVLKRRR Sbjct: 76 DFGSNNGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRR 135 Query: 607 AKGRKVLCTKSNPSSGKR 660 AKGRKVLCTKSNP+SGKR Sbjct: 136 AKGRKVLCTKSNPNSGKR 153 >ONK78486.1 uncharacterized protein A4U43_C02F19270 [Asparagus officinalis] Length = 143 Score = 92.8 bits (229), Expect = 2e-19 Identities = 51/69 (73%), Positives = 52/69 (75%) Frame = +1 Query: 457 QRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGRKVLCTK 636 QR R LQVRAGKAALCLTKRSRSRKSLA AVLKRRRAKGRKVLCTK Sbjct: 75 QRYRGLQVRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGRKVLCTK 134 Query: 637 SNPSSGKRA 663 SNP+SGKRA Sbjct: 135 SNPNSGKRA 143 >XP_017631621.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium arboreum] Length = 152 Score = 92.0 bits (227), Expect = 4e-19 Identities = 52/78 (66%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +1 Query: 430 DFG-NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRR 606 DFG N GV +RRR L VRAGKAALC TKR+RSRKSLA A+LKRRR Sbjct: 75 DFGSNNGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRR 134 Query: 607 AKGRKVLCTKSNPSSGKR 660 AKGRKVLCTKSNP+SGKR Sbjct: 135 AKGRKVLCTKSNPNSGKR 152 >JAT64435.1 50S ribosomal protein L34, chloroplastic, partial [Anthurium amnicola] Length = 176 Score = 92.4 bits (228), Expect = 5e-19 Identities = 51/78 (65%), Positives = 54/78 (69%) Frame = +1 Query: 430 DFGNVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRA 609 D G V +R R LQVRAGKA LC+TKR+RSRKSLA AVLKRRRA Sbjct: 99 DLGFSNVRRERHRGLQVRAGKATLCMTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRA 158 Query: 610 KGRKVLCTKSNPSSGKRA 663 KGRKVLCTKSNPSSGKRA Sbjct: 159 KGRKVLCTKSNPSSGKRA 176 >XP_009386293.1 PREDICTED: 50S ribosomal protein L34, chloroplastic [Musa acuminata subsp. malaccensis] Length = 148 Score = 90.9 bits (224), Expect = 1e-18 Identities = 50/78 (64%), Positives = 55/78 (70%) Frame = +1 Query: 430 DFGNVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRA 609 D G+ V +R R LQVRAGKAALC TKRSRSRKSLA AV++RRRA Sbjct: 71 DLGSSRVVKERYRGLQVRAGKAALCTTKRSRSRKSLARTHGFRRRMRTPSGRAVIRRRRA 130 Query: 610 KGRKVLCTKSNPSSGKRA 663 KGRKVLCTKSNP+SGKRA Sbjct: 131 KGRKVLCTKSNPNSGKRA 148 >OMO65329.1 Ribosomal protein L34 [Corchorus olitorius] Length = 81 Score = 88.2 bits (217), Expect = 2e-18 Identities = 48/74 (64%), Positives = 53/74 (71%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 N G+ Q+RR L VRAGKAALCLTKR+RSRKSLA A+LKRRRAKGR Sbjct: 6 NNGLGNQKRRGLVVRAGKAALCLTKRNRSRKSLARTHGFRRRMRTTGGRAILKRRRAKGR 65 Query: 619 KVLCTKSNPSSGKR 660 KVLC KSNP+SGKR Sbjct: 66 KVLCPKSNPNSGKR 79 >P82244.1 RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor 3BBO_4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome 5MLC_4 Chain 4, Cryo-em Structure Of The Spinach Chloroplast Ribosome Reveals The Location Of Plastid-specific Ribosomal Proteins And Extensions 5MMI_3 Chain 3, Structure Of The Large Subunit Of The Chloroplast Ribosome AAF64157.1 plastid ribosomal protein L34 precursor [Spinacia oleracea] KNA18199.1 hypothetical protein SOVF_073030 [Spinacia oleracea] Length = 152 Score = 90.1 bits (222), Expect = 2e-18 Identities = 49/75 (65%), Positives = 52/75 (69%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 N GV R R VRAGKAALCLTKRSRSRKSLA A+LKRRRAKGR Sbjct: 76 NTGVSTDRCRRFVVRAGKAALCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGR 135 Query: 619 KVLCTKSNPSSGKRA 663 K+LCTK+NPSSGKRA Sbjct: 136 KILCTKTNPSSGKRA 150 >CBI30669.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 88.6 bits (218), Expect = 3e-18 Identities = 50/75 (66%), Positives = 53/75 (70%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 +VGV +R L VRAGKAALC TKR+RSRKSLA AVLKRRRAKGR Sbjct: 39 SVGVRKERGHGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 98 Query: 619 KVLCTKSNPSSGKRA 663 KVLCTKSNPSSGKRA Sbjct: 99 KVLCTKSNPSSGKRA 113 >KHG06612.1 50S ribosomal protein L34, chloroplastic [Gossypium arboreum] Length = 250 Score = 92.0 bits (227), Expect = 4e-18 Identities = 52/78 (66%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +1 Query: 430 DFG-NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRR 606 DFG N GV +RRR L VRAGKAALC TKR+RSRKSLA A+LKRRR Sbjct: 173 DFGSNNGVKNERRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRALLKRRR 232 Query: 607 AKGRKVLCTKSNPSSGKR 660 AKGRKVLCTKSNP+SGKR Sbjct: 233 AKGRKVLCTKSNPNSGKR 250 >XP_008349209.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Malus domestica] XP_008358655.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Malus domestica] Length = 152 Score = 89.4 bits (220), Expect = 4e-18 Identities = 50/75 (66%), Positives = 54/75 (72%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 +VGV +R L VRAGKAALCLTKRSRSRKSLA A++KRRRAKGR Sbjct: 78 SVGVGRRRGSGLVVRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTGGRAMMKRRRAKGR 137 Query: 619 KVLCTKSNPSSGKRA 663 KVLCTKSNPSSGKRA Sbjct: 138 KVLCTKSNPSSGKRA 152 >XP_008371452.1 PREDICTED: 50S ribosomal protein L34, chloroplastic [Malus domestica] Length = 153 Score = 89.4 bits (220), Expect = 4e-18 Identities = 50/75 (66%), Positives = 54/75 (72%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 +VGV +R L VRAGKAALCLTKRSRSRKSLA A++KRRRAKGR Sbjct: 79 SVGVGRRRGSGLVVRAGKAALCLTKRSRSRKSLARTHGFRRRMRTTGGRAMMKRRRAKGR 138 Query: 619 KVLCTKSNPSSGKRA 663 KVLCTKSNPSSGKRA Sbjct: 139 KVLCTKSNPSSGKRA 153 >XP_017603423.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium arboreum] Length = 157 Score = 89.4 bits (220), Expect = 5e-18 Identities = 49/74 (66%), Positives = 53/74 (71%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 N GV ++RR L VRAGKAALC TKR+RSRKSLA AVLKRRRAKGR Sbjct: 84 NNGVRNEKRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGIAVLKRRRAKGR 143 Query: 619 KVLCTKSNPSSGKR 660 KVLCTKSNP+SGKR Sbjct: 144 KVLCTKSNPNSGKR 157 >XP_016687506.1 PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Gossypium hirsutum] Length = 157 Score = 89.4 bits (220), Expect = 5e-18 Identities = 49/74 (66%), Positives = 53/74 (71%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 N GV ++RR L VRAGKAALC TKR+RSRKSLA AVLKRRRAKGR Sbjct: 84 NNGVRNEKRRCLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 143 Query: 619 KVLCTKSNPSSGKR 660 KVLCTKSNP+SGKR Sbjct: 144 KVLCTKSNPNSGKR 157 >XP_007025416.1 PREDICTED: 50S ribosomal protein L34, chloroplastic [Theobroma cacao] EOY28038.1 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 89.0 bits (219), Expect = 6e-18 Identities = 49/75 (65%), Positives = 54/75 (72%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 N GV ++RR L VRAGKAALC TKR+RSRKSLA AVLKRRRAKGR Sbjct: 84 NNGVRNEKRRGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 143 Query: 619 KVLCTKSNPSSGKRA 663 KVLCTKSNP+SGKR+ Sbjct: 144 KVLCTKSNPNSGKRS 158 >XP_002274637.3 PREDICTED: 50S ribosomal protein L34, chloroplastic [Vitis vinifera] Length = 148 Score = 88.6 bits (218), Expect = 7e-18 Identities = 50/75 (66%), Positives = 53/75 (70%) Frame = +1 Query: 439 NVGVPIQRRRVLQVRAGKAALCLTKRSRSRKSLAXXXXXXXXXXXXXXXAVLKRRRAKGR 618 +VGV +R L VRAGKAALC TKR+RSRKSLA AVLKRRRAKGR Sbjct: 74 SVGVRKERGHGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAVLKRRRAKGR 133 Query: 619 KVLCTKSNPSSGKRA 663 KVLCTKSNPSSGKRA Sbjct: 134 KVLCTKSNPSSGKRA 148