BLASTX nr result
ID: Alisma22_contig00001989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00001989 (234 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020095726.1 uncharacterized protein LOC109715226 isoform X2 [... 51 1e-05 >XP_020095726.1 uncharacterized protein LOC109715226 isoform X2 [Ananas comosus] Length = 273 Score = 51.2 bits (121), Expect = 1e-05 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 232 IDTPFNVWVLPASRNDGEEMPEIGVNDPSLSF 137 ID PFNVWVLP+S+N EMPEIG NDPS+ + Sbjct: 179 IDAPFNVWVLPSSKNSELEMPEIGGNDPSVIY 210