BLASTX nr result
ID: Alisma22_contig00001980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00001980 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP58980.1 hypothetical protein KK1_014405 [Cajanus cajan] 49 4e-06 KYP48169.1 Retrovirus-related Pol polyprotein from transposon TN... 52 4e-06 KYP61340.1 hypothetical protein KK1_015827 [Cajanus cajan] 52 4e-06 KYP63559.1 Retrovirus-related Pol polyprotein from transposon TN... 52 6e-06 >KYP58980.1 hypothetical protein KK1_014405 [Cajanus cajan] Length = 71 Score = 49.3 bits (116), Expect = 4e-06 Identities = 20/50 (40%), Positives = 35/50 (70%) Frame = +2 Query: 74 GFVSLTPKINFKSVHYVPAFPFNLLSVAKLVDTVNCTVAFGPSCFVPGSQ 223 G V L+P ++ +V YVP PFNLLS+++L +++C ++F +CF+ G + Sbjct: 13 GTVHLSPSLSIDNVLYVPKSPFNLLSLSRLTRSLDCLISFTKNCFLTGPE 62 >KYP48169.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 224 Score = 52.0 bits (123), Expect = 4e-06 Identities = 23/46 (50%), Positives = 32/46 (69%) Frame = +2 Query: 74 GFVSLTPKINFKSVHYVPAFPFNLLSVAKLVDTVNCTVAFGPSCFV 211 G VSLTP +N SV ++P PFNL+S++KL ++NC+V F FV Sbjct: 28 GQVSLTPSLNLNSVLFIPNCPFNLISLSKLTKSLNCSVTFNVESFV 73 >KYP61340.1 hypothetical protein KK1_015827 [Cajanus cajan] Length = 227 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +2 Query: 74 GFVSLTPKINFKSVHYVPAFPFNLLSVAKLVDTVNCTVAFGPSCFV 211 G VSLTP +N KSV +VP FNL+S++KL ++NC+V F + FV Sbjct: 116 GQVSLTPSLNLKSVLFVPKCAFNLISLSKLTKSLNCSVTFDANSFV 161 >KYP63559.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1378 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = +2 Query: 74 GFVSLTPKINFKSVHYVPAFPFNLLSVAKLVDTVNCTVAFGPSCFV 211 G VSLTP +N KSV +VP FNL+S++KL ++NC+V F + FV Sbjct: 366 GQVSLTPSLNLKSVLFVPKCAFNLISLSKLTKSLNCSVTFDANSFV 411